|
|
Protein FULL name: ATR-interacting protein isoform 1 [Homo sapiens].
ATRIP (Homo sapiens) is product of expression of
ATRIP
gene.
ATRIP is involved in:
DDS in Homo sapiens
Keywords:
FUNCTION: Required for checkpoint signaling after DNA damage.
Required for ATR expression, possibly by stabilizing the protein.
SUBUNIT: Heterodimer with ATR. The heterodimer binds the RPA
complex and is then recruited to single stranded DNA. Interacts
with CEP164 (via N-terminus). Interacts with CINP.
SUBCELLULAR LOCATION: Nucleus. Note=Redistributes to discrete
nuclear foci upon DNA damage.
TISSUE SPECIFICITY: Ubiquitous.
DOMAIN: The EEXXXDDL motif is required for the interaction with
catalytic subunit PRKDC and its recruitment to sites of DNA
damage.
PTM: Phosphorylated by ATR.
SIMILARITY: Belongs to the ATRIP family.
CAUTION: The gene for this protein is either identical to or
adjacent to that of TREX1. Some of the mRNAs that encode ATRIP
also encode TREX1 in another reading frame.
SEQUENCE CAUTION:
Sequence=BAB14029.1; Type=Erroneous initiation; Note=Translation N-terminally extended;
Sequence=BAB14029.1; Type=Frameshift; Positions=650;
Sequence=BAF84257.1; Type=Erroneous initiation;
Links to other databases:
Protein sequence:
MAGTSAPGSKRRSEPPAPRPGPPPGTGHPPSKRARGFSAAAAPDPDDPFG
AHGDFTADDLEELDTLASQALSQCPAAARDVSSDHKVHRLLDGMSKNPSG
KNRETVPIKDNFELEVLQAQYKELKEKMKVMEEEVLIKNGEIKILRDSLH
QTESVLEEQRRSHFLLEQEKTQALSDKEKEFSKKLQSLQSELQFKDAEMN
ELRTKLQTSERANKLAAPSVSHVSPRKNPSVVIKPEACSPQFGKTSFPTK
ESFSANMSLPHPCQTESGYKPLVGREDSKPHSLRGDSIKQEEAQKSFVDS
WRQRSNTQGSILINLLLKQPLIPGSSLSLCHLLSSSSESPAGTPLQPPGF
GSTLAGMSGLRTTGSYDGSFSLSALREAQNLAFTGLNLVARNECSRDGDP
AEGGRRAFPLCQLPGAVHFLPLVQFFIGLHCQALQDLAAAKRSGAPGDSP
THSSCVSSGVETNPEDSVCILEGFSVTALSILQHLVCHSGAVVSLLLSGV
GADSAAGEGNRSLVHRLSDGDMTSALRGVADDQGQHPLLKMLLHLLAFSS
AATGHLQASVLTQCLKVLVKLAENTSCDFLPRFQCVFQVLPKCLSPETPL
PSVLLAVELLSLLADHDQLAPQLCSHSEGCLLLLLYMYITSRPDRVALET
QWLQLEQEVVWLLAKLGVQSPLPPVTGSNCQCNVEVVRALTVMLHRQWLT
VRRAGGPPRTDQQRRTVRCLRDTVLLLHGLSQKDKLFMMHCVEVLHQFDQ
VMPGVSMLIRGLPDVTDCEEAALDDLCAAETDVEDPEVECG
|
ATRIP (Homo sapiens) belongs to following protein families:
References:
|
Title
|
Authors
|
Journal
|
|
ATR and ATRIP: partners in checkpoint signaling.
|
Cortez D, Guntuku S, Qin J, Elledge SJ
|
Science
Nov. 23, 2001
|
|
Sensing DNA damage through ATRIP recognition of RPA-ssDNA complexes.
|
Zou L, Elledge SJ
|
Science
June 6, 2003
|
|
Complete sequencing and characterization of 21,243 full-length human cDNAs.
|
Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S
|
Nat Genet
Feb. 1, 2004
|
|
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
|
Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J
|
Genome Res
Oct. 1, 2004
|
|
Conserved modes of recruitment of ATM, ATR and DNA-PKcs to sites of DNA damage.
|
Falck J, Coates J, Jackson SP
|
Nature
March 31, 2005
|
|
The full-ORF clone resource of the German cDNA Consortium.
|
Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I
|
BMC Genomics
Jan. 1, 2007
|
|
The proteomic reactor facilitates the analysis of affinity-purified proteins by mass spectrometry: application for identifying ubiquitinated proteins in human cells.
|
Vasilescu J, Zweitzig DR, Denis NJ, Smith JC, Ethier M, Haines DS, Figeys D
|
J Proteome Res
Feb. 1, 2007
|
|
Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
|
Yu LR, Zhu Z, Chan KC, Issaq HJ, Dimitrov DS, Veenstra TD
|
J Proteome Res
Nov. 1, 2007
|
|
Cep164 is a mediator protein required for the maintenance of genomic stability through modulation of MDC1, RPA, and CHK1.
|
Sivasubramaniam S, Sun X, Pan YR, Wang S, Lee EY
|
Genes Dev
March 1, 2008
|
|
A quantitative atlas of mitotic phosphorylation.
|
Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP
|
Proc Natl Acad Sci U S A
Aug. 5, 2008
|
|
Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
|
Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK
|
Sci Signal
Jan. 1, 2009
|
|
Functional genomic screens identify CINP as a genome maintenance protein.
|
Lovejoy CA, Xu X, Bansbach CE, Glick GG, Zhao R, Ye F, Sirbu BM, Titus LC, Shyr Y, Cortez D
|
Proc Natl Acad Sci U S A
Nov. 17, 2009
|
Last modification of this entry: Oct. 22, 2010.
Add your own comment!
There is no comment yet.
|