|
|
Protein FULL name: UV excision repair protein RAD23 homolog A [Homo sapiens].
RAD23A (Homo sapiens) is product of expression of
RAD23A
gene.
RAD23A is involved in:
DDS in Homo sapiens
Keywords:
FUNCTION: Involved in postreplication repair of UV-damaged DNA.
Postreplication repair functions in gap-filling of a daughter
strand on replication of damaged DNA (Potential).
SUBUNIT: Interacts with MJD. Interacts with HIV-1 Vpr.
INTERACTION:
Q13501:SQSTM1; NbExp=1; IntAct=EBI-746453, EBI-307104;
SUBCELLULAR LOCATION: Nucleus (Probable).
DOMAIN: The ubiquitin-like domain mediates interaction with MJD.
PTM: Phosphorylated upon DNA damage, probably by ATM or ATR.
SIMILARITY: Belongs to the RAD23 family.
SIMILARITY: Contains 2 UBA domains.
SIMILARITY: Contains 1 ubiquitin-like domain.
WEB RESOURCE: Name=NIEHS-SNPs;
[LINK]
Links to other databases:
Protein sequence:
MAVTITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIY
AGKILSDDVPIRDYRIDEKNFVVVMVTKTKAGQGTSAPPEASPTAAPESS
TSFPPAPTSGMSHPPPAAREDKSPSEESAPTTSPESVSGSVPSSGSSGRE
EDAASTLVTGSEYETMLTEIMSMGYERERVVAALRASYNNPHRAVEYLLT
GIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFLRDQPQFQNMRQVIQQ
NPALLPALLQQLGQENPQLLQQISRHQEQFIQMLNEPPGELADISDVEGE
VGAIGEEAPQMNYIQVTPQEKEAIERLKALGFPESLVIQAYFACEKNENL
AANFLLSQNFDDE
|
RAD23A (Homo sapiens) belongs to following protein families:
References:
|
Title
|
Authors
|
Journal
|
|
Purification and cloning of a nucleotide excision repair complex involving the xeroderma pigmentosum group C protein and a human homologue of yeast RAD23.
|
Masutani C, Sugasawa K, Yanagisawa J, Sonoyama T, Ui M, Enomoto T, Takio K, Tanaka K, van der Spek PJ, Bootsma D, et al.
|
EMBO J
April 15, 1994
|
|
Human immunodeficiency virus type 1 Vpr interacts with HHR23A, a cellular protein implicated in nucleotide excision DNA repair.
|
Withers-Ward ES, Jowett JB, Stewart SA, Xie YM, Garfinkel A, Shibagaki Y, Chow SA, Shah N, Hanaoka F, Sawitz DG, Armstrong RW, Souza LM, Chen IS
|
J Virol
Dec. 1, 1997
|
|
Structure of a human DNA repair protein UBA domain that interacts with HIV-1 Vpr.
|
Dieckmann T, Withers-Ward ES, Jarosinski MA, Liu CF, Chen IS, Feigon J
|
Nat Struct Biol
Dec. 1, 1998
|
|
Biochemical and structural analysis of the interaction between the UBA(2) domain of the DNA repair protein HHR23A and HIV-1 Vpr.
|
Withers-Ward ES, Mueller TD, Chen IS, Feigon J
|
Biochemistry
Nov. 21, 2000
|
|
The DNA sequence and biology of human chromosome 19.
|
Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM
|
Nature
April 1, 2004
|
|
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
|
Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J
|
Genome Res
Oct. 1, 2004
|
|
Global proteomic profiling of phosphopeptides using electron transfer dissociation tandem mass spectrometry.
|
Molina H, Horn DM, Tang N, Mathivanan S, Pandey A
|
Proc Natl Acad Sci U S A
Jan. 13, 2007
|
|
ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
|
Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ
|
Science
May 25, 2007
|
|
Quantitative phosphoproteome profiling of Wnt3a-mediated signaling network: indicating the involvement of ribonucleoside-diphosphate reductase M2 subunit phosphorylation at residue serine 20 in canonical Wnt signal transduction.
|
Tang LY, Deng N, Wang LS, Dai J, Wang ZL, Jiang XS, Li SJ, Li L, Sheng QH, Wu DQ, Li L, Zeng R
|
Mol Cell Proteomics
Nov. 1, 2007
|
|
A quantitative atlas of mitotic phosphorylation.
|
Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP
|
Proc Natl Acad Sci U S A
Aug. 5, 2008
|
|
Quantitative analysis of global ubiquitination in HeLa cells by mass spectrometry.
|
Meierhofer D, Wang X, Huang L, Kaiser P
|
J Proteome Res
Oct. 1, 2008
|
Last modification of this entry: Oct. 15, 2010.
Add your own comment!
There is no comment yet.
|