|
|
Protein FULL name: essential meiotic endonuclease 1 homolog 1 [Homo sapiens].
EME1 (Homo sapiens) is product of expression of
EME1
gene.
EME1 is involved in:
HRR in Homo sapiens
Keywords:
FUNCTION: Interacts with MUS81 to form a DNA structure-specific
endonuclease with substrate preference for branched DNA structures
with a 5'-end at the branch nick. Typical substrates include 3'-
flap structures, replication forks and nicked Holliday junctions.
May be required in mitosis for the processing of stalled or
collapsed replication forks.
COFACTOR: Magnesium.
SUBUNIT: May self-associate. Interacts with MUS81. Interacts with
ERCC4 and FANCM.
INTERACTION:
Q8IY92:BTBD12; NbExp=1; IntAct=EBI-2370825, EBI-2370740;
SUBCELLULAR LOCATION: Nucleus, nucleolus. Note=Recruited to
regions of DNA damage in S-phase cells.
SIMILARITY: Belongs to the EME1/MMS4 family.
Links to other databases:
Protein sequence:
MALKKSSPSLDSGDSDSEELPTFAFLKKEPSSTKRRQPEREEKIVVVDIS
DCEASCPPAPELFSPPVPDIAETVTQTQPVRLLSSESEDEEEFIPLAQRL
TCKFLTHKQLSPEDSSSPVKSVLDHQNNEGASCDWKKPFPKIPEVPLHDT
PERSAADNKDLILDPCCQLPAYLSTCPGQSSSLAVTKTNSDILPPQKKTK
PSQKVQGRGSHGCQQQRQARQKESTLRRQERKNAALVTRMKAQRPEECLK
HIIVVLDPVLLQMEGGGQLLGALQTMECRCVIEAQAVPCSVTWRRRAGPS
EDREDWVEEPTVLVLLRAEAFVSMIDNGKQGSLDSTMKGKETLQGFVTDI
TAKTAGKALSLVIVDQEKCFSAQNPPRRGKQGANKQTKKQQQRQPEASIG
SMVSRVDAEEALVDLQLHTEAQAQIVQSWKELADFTCAFTKAVAEAPFKK
LRDETTFSFCLESDWAGGVKVDLAGRGLALVWRRQIQQLNRVSLEMASAV
VNAYPSPQLLVQAYQQCFSDKERQNLLADIQVRRGEGVTSTSRRIGPELS
RRIYLQMTTLQPHLSLDSAD
|
EME1 (Homo sapiens) is able to recognize following damages:
EME1 (Homo sapiens) belongs to following protein families:
References:
|
Title
|
Authors
|
Journal
|
|
Identification and characterization of human MUS81-MMS4 structure-specific endonuclease.
|
Ogrunc M, Sancar A
|
J Biol Chem
June 13, 2003
|
|
Identification and characterization of the human mus81-eme1 endonuclease.
|
Ciccia A, Constantinou A, West SC
|
J Biol Chem
July 4, 2003
|
|
RNA interference inhibition of Mus81 reduces mitotic recombination in human cells.
|
Blais V, Gao H, Elwell CA, Boddy MN, Gaillard PH, Russell P, McGowan CH
|
Mol Biol Cell
Jan. 1, 2004
|
|
Complete sequencing and characterization of 21,243 full-length human cDNAs.
|
Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S
|
Nat Genet
Feb. 1, 2004
|
|
Large-scale characterization of HeLa cell nuclear phosphoproteins.
|
Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP
|
Proc Natl Acad Sci U S A
Aug. 17, 2004
|
|
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
|
Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J
|
Genome Res
Oct. 1, 2004
|
|
Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
|
Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M
|
Cell
Nov. 3, 2006
|
|
Identification of FAAP24, a Fanconi anemia core complex protein that interacts with FANCM.
|
Ciccia A, Ling C, Coulthard R, Yan Z, Xue Y, Meetei AR, Laghmani el H, Joenje H, McDonald N, de Winter JP, Wang W, West SC
|
Mol Cell
Jan. 9, 2007
|
|
Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
|
Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd
|
J Proteome Res
March 1, 2008
|
|
A quantitative atlas of mitotic phosphorylation.
|
Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP
|
Proc Natl Acad Sci U S A
Aug. 5, 2008
|
|
Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
|
Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK
|
Sci Signal
Jan. 1, 2009
|
|
Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
|
Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S
|
Anal Chem
June 1, 2009
|
Last modification of this entry: Oct. 12, 2010.
Add your own comment!
There is no comment yet.
|