|
|
Protein FULL name: exonuclease 1 isoform a [Homo sapiens].
EXO1 (Homo sapiens) is product of expression of
EXO1
gene.
EXO1 is involved in:
MMR in Homo sapiens
Keywords:
FUNCTION: 5'->3' double-stranded DNA exonuclease which may also
possess a cryptic 3'->5' double-stranded DNA exonuclease activity.
Functions in DNA mismatch repair (MMR) to excise mismatch-
containing DNA tracts directed by strand breaks located either 5'
or 3' to the mismatch. Also exhibits endonuclease activity against
5'-overhanging flap structures similar to those generated by
displacement synthesis when DNA polymerase encounters the 5'-end
of a downstream Okazaki fragment. Required for somatic
hypermutation (SHM) and class switch recombination (CSR) of
immunoglobulin genes. Essential for male and female meiosis.
COFACTOR: Binds 2 magnesium ions per subunit. They probably
participate in the reaction catalyzed by the enzyme. May bind an
additional third magnesium ion after substrate binding (By
similarity).
SUBUNIT: Interacts with the MLH1-PMS2 heterodimer via MLH1.
Interacts with MSH3. Interacts with the MSH2-MSH6 heterodimer via
MSH2, and this interaction may increase the processivity of the
5'->3' exonuclease activity. Interacts with PCNA, and this
interaction may both stimulate the cryptic 3'->5' exonuclease
activity and suppress the 5'->3' exonuclease activity. Interacts
with WRN, and this interaction stimulates both the 5'->3'
exonuclease activity and cleavage of 5'-overhanging flap
structures. Interacts with RECQL/RECQ1, and this interaction
stimulates cleavage of 5'-overhanging flap structures.
INTERACTION:
P43246:MSH2; NbExp=2; IntAct=EBI-944694, EBI-355888;
SUBCELLULAR LOCATION: Nucleus. Note=Colocalizes with PCNA to
discrete nuclear foci in S-phase.
TISSUE SPECIFICITY: Highly expressed in bone marrow, testis and
thymus. Expressed at lower levels in colon, lymph nodes, ovary,
placenta, prostate, small intestine, spleen and stomach.
DEVELOPMENTAL STAGE: Highly expressed in fetal liver and at lower
levels in fetal brain, heart, kidney, spleen and thymus.
PTM: Phosphorylated upon DNA damage and in response to agents
stalling DNA replication, probably by ATM or ATR. Phosphorylation
at Ser-454, Thr-621 and Ser-714 is induced upon DNA-damage caused
by treatment with hydroxyurea (HU) but not upon IR treatment. The
HU-induced EXO1 triple phosphorylation facilitates
destabilisation/degradation of the protein.
POLYMORPHISM: Most naturally occurring variants in this protein
are not associated with familial disposition to hereditary non-
polyposis colorectal cancer (HNPCC). Furthermore, germline
deletions involving this locus are not associated with clinically
manifested colorectal tumors.
SIMILARITY: Belongs to the XPG/RAD2 endonuclease family. EXO1
subfamily.
SEQUENCE CAUTION:
Sequence=AAC33874.1; Type=Frameshift; Positions=793;
WEB RESOURCE: Name=NIEHS-SNPs;
[LINK]
Links to other databases:
Protein sequence:
MGIQGLLQFIKEASEPIHVRKYKGQVVAVDTYCWLHKGAIACAEKLAKGE
PTDRYVGFCMKFVNMLLSHGIKPILVFDGCTLPSKKEVERSRRERRQANL
LKGKQLLREGKVSEARECFTRSINITHAMAHKVIKAARSQGVDCLVAPYE
ADAQLAYLNKAGIVQAIITEDSDLLAFGCKKVILKMDQFGNGLEIDQARL
GMCRQLGDVFTEEKFRYMCILSGCDYLSSLRGIGLAKACKVLRLANNPDI
VKVIKKIGHYLKMNITVPEDYINGFIRANNTFLYQLVFDPIKRKLIPLNA
YEDDVDPETLSYAGQYVDDSIALQIALGNKDINTFEQIDDYNPDTAMPAH
SRSHSWDDKTCQKSANVSSIWHRNYSPRPESGTVSDAPQLKENPSTVGVE
RVISTKGLNLPRKSSIVKRPRSAELSEDDLLSQYSLSFTKKTKKNSSEGN
KSLSFSEVFVPDLVNGPTNKKSVSTPPRTRNKFATFLQRKNEESGAVVVP
GTRSRFFCSSDSTDCVSNKVSIQPLDETAVTDKENNLHESEYGDQEGKRL
VDTDVARNSSDDIPNNHIPGDHIPDKATVFTDEESYSFESSKFTRTISPP
TLGTLRSCFSWSGGLGDFSRTPSPSPSTALQQFRRKSDSPTSLPENNMSD
VSQLKSEESSDDESHPLREGACSSQSQESGEFSLQSSNASKLSQCSSKDS
DSEESDCNIKLLDSQSDQTSKLCLSHFSKKDTPLRNKVPGLYKSSSADSL
STTKIKPLGPARASGLSKKPASIQKRKHHNAENKPGLQIKLNELWKNFGF
KKF
|
EXO1 (Homo sapiens) is able to recognize following damages:
References:
|
Title
|
Authors
|
Journal
|
|
Hex1: a new human Rad2 nuclease family member with homology to yeast exonuclease 1.
|
Wilson DM 3rd, Carney JP, Coleman MA, Adamson AW, Christensen M, Lamerdin JE
|
Nucleic Acids Res
Aug. 15, 1998
|
|
Human exonuclease I interacts with the mismatch repair protein hMSH2.
|
Schmutte C, Marinescu RC, Sadoff MM, Guerrette S, Overhauser J, Fishel R
|
Cancer Res
Oct. 15, 1998
|
|
Identification of a human gene encoding a homologue of Saccharomyces cerevisiae EXO1, an exonuclease implicated in mismatch repair and recombination.
|
Tishkoff DX, Amin NS, Viars CS, Arden KC, Kolodner RD
|
Cancer Res
Nov. 15, 1998
|
|
Human exonuclease 1 functionally complements its yeast homologues in DNA recombination, RNA primer removal, and mutation avoidance.
|
Qiu J, Qian Y, Chen V, Guan MX, Shen B
|
J Biol Chem
June 18, 1999
|
|
The RAD2 domain of human exonuclease 1 exhibits 5' to 3' exonuclease and flap structure-specific endonuclease activities.
|
Lee BI, Wilson DM 3rd
|
J Biol Chem
Dec. 31, 1999
|
|
Identification of factors interacting with hMSH2 in the fetal liver utilizing the yeast two-hybrid system. In vivo interaction through the C-terminal domains of hEXO1 and hMSH2 and comparative expression analysis.
|
Rasmussen LJ, Rasmussen M, Lee B, Rasmussen AK, Wilson DM 3rd, Nielsen FC, Bisgaard HC
|
Mutat Res
June 1, 2000
|
|
Germline mutations of EXO1 gene in patients with hereditary nonpolyposis colorectal cancer (HNPCC) and atypical HNPCC forms.
|
Wu Y, Berends MJ, Post JG, Mensink RG, Verlind E, Van Der Sluis T, Kempinga C, Sijmons RH, van der Zee AG, Hollema H, Kleibeuker JH, Buys CH, Hofstra RM
|
Gastroenterology
June 1, 2001
|
|
HNPCC mutations in the human DNA mismatch repair gene hMLH1 influence assembly of hMutLalpha and hMLH1-hEXO1 complexes.
|
Jager AC, Rasmussen M, Bisgaard HC, Singh KK, Nielsen FC, Rasmussen LJ
|
Oncogene
June 14, 2001
|
|
The interaction of DNA mismatch repair proteins with human exonuclease I.
|
Schmutte C, Sadoff MM, Shim KS, Acharya S, Fishel R
|
J Biol Chem
Aug. 31, 2001
|
|
Molecular interactions of human Exo1 with DNA.
|
Lee Bi BI, Nguyen LH, Barsky D, Fernandes M, Wilson DM 3rd
|
Nucleic Acids Res
Jan. 15, 2002
|
|
Human exonuclease I is required for 5' and 3' mismatch repair.
|
Genschel J, Bazemore LR, Modrich P
|
J Biol Chem
April 12, 2002
|
|
Functional alterations of human exonuclease 1 mutants identified in atypical hereditary nonpolyposis colorectal cancer syndrome.
|
Sun X, Zheng L, Shen B
|
Cancer Res
Nov. 1, 2002
|
|
EXO1 variants occur commonly in normal population: evidence against a role in hereditary nonpolyposis colorectal cancer.
|
Jagmohan-Changur S, Poikonen T, Vilkki S, Launonen V, Wikman F, Orntoft TF, Moller P, Vasen H, Tops C, Kolodner RD, Mecklin JP, Jarvinen H, Bevan S, Houlston RS, Aaltonen LA, Fodde R, Wijnen J, Karhu A
|
Cancer Res
Feb. 1, 2003
|
|
The exonucleolytic and endonucleolytic cleavage activities of human exonuclease 1 are stimulated by an interaction with the carboxyl-terminal region of the Werner syndrome protein.
|
Sharma S, Sommers JA, Driscoll HC, Uzdilla L, Wilson TM, Brosh RM Jr
|
J Biol Chem
June 27, 2003
|
|
Mechanism of 5'-directed excision in human mismatch repair.
|
Genschel J, Modrich P
|
Mol Cell
Nov. 1, 2003
|
|
Germline deletions of EXO1 do not cause colorectal tumors and lesions which are null for EXO1 do not have microsatellite instability.
|
Alam NA, Gorman P, Jaeger EE, Kelsell D, Leigh IM, Ratnavel R, Murdoch ME, Houlston RS, Aaltonen LA, Roylance RR, Tomlinson IP
|
Cancer Genet Cytogenet
Dec. 1, 2003
|
|
Characterization of human exonuclease 1 in complex with mismatch repair proteins, subcellular localization and association with PCNA.
|
Nielsen FC, Jager AC, Lutzen A, Bundgaard JR, Rasmussen LJ
|
Oncogene
Jan. 19, 2004
|
|
Hereditary non-polyposis colorectal cancer and the role of hPMS2 and hEXO1 mutations.
|
Thompson E, Meldrum CJ, Crooks R, McPhillips M, Thomas L, Spigelman AD, Scott RJ
|
Clin Genet
March 1, 2004
|
|
A defined human system that supports bidirectional mismatch-provoked excision.
|
Dzantiev L, Constantin N, Genschel J, Iyer RR, Burgers PM, Modrich P
|
Mol Cell
July 2, 2004
|
|
Large-scale characterization of HeLa cell nuclear phosphoproteins.
|
Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP
|
Proc Natl Acad Sci U S A
Aug. 17, 2004
|
|
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
|
Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J
|
Genome Res
Oct. 1, 2004
|
|
Single nucleotide polymorphisms in the EXO1 gene and risk of colorectal cancer in a Japanese population.
|
Yamamoto H, Hanafusa H, Ouchida M, Yano M, Suzuki H, Murakami M, Aoe M, Shimizu N, Nakachi K, Shimizu K
|
Carcinogenesis
Jan. 1, 2005
|
|
RECQ1 helicase interacts with human mismatch repair factors that regulate genetic recombination.
|
Doherty KM, Sharma S, Uzdilla LA, Wilson TM, Cui S, Vindigni A, Brosh RM Jr
|
J Biol Chem
July 1, 2005
|
|
Reconstitution of 5'-directed human mismatch repair in a purified system.
|
Zhang Y, Yuan F, Presnell SR, Tian K, Gao Y, Tomkinson AE, Gu L, Li GM
|
Cell
Sept. 9, 2005
|
|
The DNA sequence and biological annotation of human chromosome 1.
|
Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E
|
Nature
May 18, 2006
|
|
The full-ORF clone resource of the German cDNA Consortium.
|
Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I
|
BMC Genomics
Jan. 1, 2007
|
|
Nuclear localization of human DNA mismatch repair protein exonuclease 1 (hEXO1).
|
Knudsen NO, Nielsen FC, Vinther L, Bertelsen R, Holten-Andersen S, Liberti SE, Hofstra R, Kooi K, Rasmussen LJ
|
Nucleic Acids Res
Jan. 1, 2007
|
|
ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
|
Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ
|
Science
May 25, 2007
|
|
ATR-dependent pathways control hEXO1 stability in response to stalled forks.
|
El-Shemerly M, Hess D, Pyakurel AK, Moselhy S, Ferrari S
|
Nucleic Acids Res
Jan. 1, 2008
|
|
Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
|
Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd
|
J Proteome Res
March 1, 2008
|
|
A quantitative atlas of mitotic phosphorylation.
|
Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP
|
Proc Natl Acad Sci U S A
Aug. 5, 2008
|
|
Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
|
Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S
|
Anal Chem
June 1, 2009
|
|
Lysine acetylation targets protein complexes and co-regulates major cellular functions.
|
Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M
|
Science
Aug. 14, 2009
|
Last modification of this entry: Oct. 12, 2010.
Add your own comment!
There is no comment yet.
|