Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
EME2 |
Protein FULL name:
probable crossover junction endonuclease EME2 [Homo sapiens].
EME2 (Homo sapiens) is product of expression of EME2 gene.
EME2 is involved in:
HRR in Homo sapiens
Keywords:
FUNCTION: Interacts with MUS81 to form a DNA structure-specific endonuclease which cleaves substrates such as 3'-flap structures.
SUBUNIT: Interacts with MUS81.
SUBCELLULAR LOCATION: Nucleus (Probable).
SIMILARITY: Belongs to the EME1/MMS4 family.
SEQUENCE CAUTION: Sequence=AAK61292.1; Type=Erroneous gene model prediction; Sequence=BAB84906.2; Type=Erroneous initiation;
| NCBI GenPept GI number(s): |
58197552 |
| Species: | Homo sapiens |
Links to other databases:
| Database | ID | Link |
| Uniprot | A4GXA9 |
A4GXA9 |
| PFAM: | - |
A4GXA9 (Link - using uniprot id) |
| InterPro: | - |
A4GXA9 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MARVGPGRAGVSCQGRGRGRGGSGQRRPPTWEISDSDAEDSAGSEAAARA RDPAGERRAAAEALRLLRPEQVLKRLAVCVDTAILEDAGADVLMEALEAL GCECRIEPQRPARSLRWTRASPDPCPRSLPPEVWAAGEQELLLLLEPEEF LQGVATLTQISGPTHWVPWISPETTARPHLAVIGLDAYLWYRSLSCPQQG WLGRGFRGGGLWQRPSSGRAGPMGSGEEWSPLLRSRQHVSRGTQQPESPK VAGAEVAVSWPEVEEVRACLSWALVLLQLWANLDVLLVASWQELSRHVCA VTKALAQYPLKCVMPRLKGGRITSRQYRESQAFSFCTAGRWAAGEPVARD GAGLQAAWRRQIRQFSRVSPAVADAVVTAFPSPRLLQQALEACSTERERM GLLADLPVPPSEGGRPRRVGPDLSRRICLFLTTANPDLLLDLGS |
EME2 (Homo sapiens) is able to recognize following damages:
EME2 (Homo sapiens) belongs to following protein families:
References:
| Title | Authors | Journal |
| Sequence, structure and pathology of the fully annotated terminal 2 Mb of the short arm of human chromosome 16. | Daniels RJ, Peden JF, Lloyd C, Horsley SW, Clark K, Tufarelli C, Kearney L, Buckle VJ, Doggett NA, Flint J, Higgs DR | Hum Mol Genet Jan. 15, 2001 |
| Characterization of long cDNA clones from human adult spleen. II. The complete sequences of 81 cDNA clones. | Jikuya H, Takano J, Kikuno R, Hirosawa M, Nagase T, Nomura N, Ohara O | DNA Res Jan. 28, 2003 |
| Identification of FAAP24, a Fanconi anemia core complex protein that interacts with FANCM. | Ciccia A, Ling C, Coulthard R, Yan Z, Xue Y, Meetei AR, Laghmani el H, Joenje H, McDonald N, de Winter JP, Wang W, West SC | Mol Cell Jan. 9, 2007 |
Last modification of this entry: Oct. 12, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|