Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
MutH |
Protein FULL name:
DNA mismatch repair protein mutH, Methyl-directed mismatch repair protein.,
MutH (Escherichia coli strain K-12 substr. MG1655) is product of expression of mutH gene.
MutH is involved in:
MMR in Escherichia coli strain K-12 substr. MG1655
- MutH nicks DNA 5' to mismatch in Escherichia coli strain K-12 substr. MG1655
- MutH nicks DNA 3' to mismatch in Escherichia coli strain K-12 substr. MG1655
Keywords:
FUNCTION: Sequence-specific endonuclease that cleaves unmethylated GATC sequences. It is involved in DNA mismatch repair.
INTERACTION: P76217:astD; NbExp=1; IntAct=EBI-545170, EBI-545161; P23367:mutL; NbExp=2; IntAct=EBI-545170, EBI-554913;
SUBCELLULAR LOCATION: Cytoplasm.
SIMILARITY: Belongs to the mutH family.
| NCBI GenPept GI number(s): |
730086 42065 |
| Species: | Escherichia coli |
Links to other databases:
| Database | ID | Link |
| Uniprot | P06722 |
P06722 |
| PFAM: |
PF02976 |
PF02976 |
| InterPro: |
IPR004230 IPR018140 IPR011335 |
IPR004230 IPR018140 IPR011335 |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MSQPRPLLSPPETEEQLLAQAQQLSGYTLGELAALVGLVTPENLKRDKGW IGVLLEIWLGASAGSKPEQDFAALGVELKTIPVDSLGRPLETTFVCVAPL TGNSGVTWETSHVRHKLKRVLWIPVEGERSIPLAQRRVGSPLLWSPNEEE DRQLREDWEELMDMIVLGQVERITARHGEYLQIRPKAANAKALTEAIGAR GERILTLPRGFYLKKNFTSALLARHFLIQ |
MutH (Escherichia coli strain K-12 substr. MG1655) is able to recognize following damages:
- base deletion frameshift
- base insertion frameshift
- AG mismatch
- AA mismatch
- CA mismatch
- CC mismatch
- CT mismatch
- GA mismatch
- GG mismatch
- GT mismatch
- TC mismatch
- TG mismatch
- TT mismatch
- base mismatch
- small deletion loop
- large deletion loop
- large insertion loop
- small insertion loop
References:
| Title | Authors | Journal |
| Nucleotide sequence of the Escherichia coli mutH gene. | Grafstrom RH, Hoess RH | Nucleic Acids Res April 10, 1987 |
| The complete genome sequence of Escherichia coli K-12. | Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y | Science Sept. 5, 1997 |
| Structural basis for MutH activation in E.coli mismatch repair and relationship of MutH to restriction endonucleases. | Ban C, Yang W | EMBO J March 2, 1998 |
| Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. | Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T | Mol Syst Biol Jan. 1, 2006 |
Last modification of this entry: Oct. 13, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|