|
|
Protein FULL name: DNA polymerase iota [Homo sapiens].
POLI (Homo sapiens) is product of expression of
POLI
gene.
POLI is involved in:
TLS in Homo sapiens
Keywords:
FUNCTION: Error-prone DNA polymerase specifically involved in DNA
repair. Plays an important role in translesion synthesis, where
the normal high-fidelity DNA polymerases cannot proceed and DNA
synthesis stalls. Favors Hoogsteen base-pairing in the active
site. Inserts the correct base with high-fidelity opposite an
adenosine template. Exhibits low fidelity and efficiency opposite
a thymidine template, where it will preferentially insert
guanosine. May play a role in hypermutation of immunogobulin
genes. Forms a Schiff base with 5'-deoxyribose phosphate at abasic
sites, but may not have lyase activity.
CATALYTIC ACTIVITY: Deoxynucleoside triphosphate + DNA(n) =
diphosphate + DNA(n+1).
COFACTOR: Magnesium.
SUBUNIT: Binds REV1L (By similarity). Binds POLH.
INTERACTION:
Q15038:DAZAP2; NbExp=2; IntAct=EBI-741774, EBI-724310;
SUBCELLULAR LOCATION: Nucleus. Note=Accumulates at replication
forks after DNA damage.
TISSUE SPECIFICITY: Ubiquitous. Highly expressed in testis.
DOMAIN: The catalytic core consists of fingers, palm and thumb
subdomains, but the fingers and thumb subdomains are much smaller
than in high-fidelity polymerases; residues from five sequence
motifs of the Y-family cluster around an active site cleft that
can accommodate DNA and nucleotide substrates with relaxed
geometric constraints, with consequently higher rates of
misincorporation and low processivity.
SIMILARITY: Belongs to the DNA polymerase type-Y family.
SIMILARITY: Contains 1 umuC domain.
WEB RESOURCE: Name=NIEHS-SNPs;
[LINK]
Links to other databases:
Protein sequence:
MEKLGVEPEEEGGGDDDEEDAEAWAMELADVGAAASSQGVHDQVLPTPNA
SSRVIVHVDLDCFYAQVEMISNPELKDKPLGVQQKYLVVTCNYEARKLGV
KKLMNVRDAKEKCPQLVLVNGEDLTRYREMSYKVTELLEEFSPVVERLGF
DENFVDLTEMVEKRLQQLQSDELSAVTVSGHVYNNQSINLLDVLHIRLLV
GSQIAAEMREAMYNQLGLTGCAGVASNKLLAKLVSGVFKPNQQTVLLPES
CQHLIHSLNHIKEIPGIGYKTAKCLEALGINSVRDLQTFSPKILEKELGI
SVAQRIQKLSFGEDNSPVILSGPPQSFSEEDSFKKCSSEVEAKNKIEELL
ASLLNRVCQDGRKPHTVRLIIRRYSSEKHYGRESRQCPIPSHVIQKLGTG
NYDVMTPMVDILMKLFRNMVNVKMPFHLTLLSVCFCNLKALNTAKKGLID
YYLMPSLSTTSRSGKHSFKMKDTHMEDFPKDKETNRDFLPSGRIESTRTR
ESPLDTTNFSKEKDINEFPLCSLPEGVDQEVFKQLPVDIQEEILSGKSRE
KFQGKGSVSCPLHASRGVLSFFSKKQMQDIPINPRDHLSSSKQVSSVSPC
EPGTSGFNSSSSSYMSSQKDYSYYLDNRLKDERISQGPKEPQGFHFTNSN
PAVSAFHSFPNLQSEQLFSRNHTTDSHKQTVATDSHEGLTENREPDSVDE
KITFPSDIDPQVFYELPEAVQKELLAEWKRAGSDFHIGHK
|
POLI (Homo sapiens) is able to recognize following damages:
POLI (Homo sapiens) belongs to following protein families:
References:
|
Title
|
Authors
|
Journal
|
|
Novel human and mouse homologs of Saccharomyces cerevisiae DNA polymerase eta.
|
McDonald JP, Rapic-Otrin V, Epstein JA, Broughton BC, Wang X, Lehmann AR, Wolgemuth DJ, Woodgate R
|
Genomics
Aug. 15, 1999
|
|
Misinsertion and bypass of thymine-thymine dimers by human DNA polymerase iota.
|
Tissier A, Frank EG, McDonald JP, Iwai S, Hanaoka F, Woodgate R
|
EMBO J
Oct. 2, 2000
|
|
Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
|
Wiemann S, Weil B, Wellenreuther R, Gassenhuber J, Glassl S, Ansorge W, Bocher M, Blocker H, Bauersachs S, Blum H, Lauber J, Dusterhoft A, Beyer A, Kohrer K, Strack N, Mewes HW, Ottenwalder B, Obermaier B, Tampe J, Heubner D, Wambutt R, Korn B, Klein M, Poustka A
|
Genome Res
March 1, 2001
|
|
5'-Deoxyribose phosphate lyase activity of human DNA polymerase iota in vitro.
|
Bebenek K, Tissier A, Frank EG, McDonald JP, Prasad R, Wilson SH, Woodgate R, Kunkel TA
|
Science
March 16, 2001
|
|
Altered nucleotide misinsertion fidelity associated with poliota-dependent replication at the end of a DNA template.
|
Frank EG, Tissier A, McDonald JP, Rapic-Otrin V, Zeng X, Gearhart PJ, Woodgate R
|
EMBO J
June 1, 2001
|
|
Induction of somatic hypermutation in immunoglobulin genes is dependent on DNA polymerase iota.
|
Faili A, Aoufouchi S, Flatter E, Gueranger Q, Reynaud CA, Weill JC
|
Nature
Oct. 31, 2002
|
|
Localization of DNA polymerases eta and iota to the replication machinery is tightly co-ordinated in human cells.
|
Kannouche P, Fernandez de Henestrosa AR, Coull B, Vidal AE, Gray C, Zicha D, Woodgate R, Lehmann AR
|
EMBO J
March 3, 2003
|
|
A mechanism for the exclusion of low-fidelity human Y-family DNA polymerases from base excision repair.
|
Haracska L, Prakash L, Prakash S
|
Genes Dev
Nov. 15, 2003
|
|
Efficient and error-free replication past a minor-groove DNA adduct by the sequential action of human DNA polymerases iota and kappa.
|
Washington MT, Minko IG, Johnson RE, Wolfle WT, Harris TM, Lloyd RS, Prakash S, Prakash L
|
Mol Cell Biol
July 1, 2004
|
|
Replication by human DNA polymerase-iota occurs by Hoogsteen base-pairing.
|
Nair DT, Johnson RE, Prakash S, Prakash L, Aggarwal AK
|
Nature
July 15, 2004
|
|
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
|
Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J
|
Genome Res
Oct. 1, 2004
|
Last modification of this entry: Oct. 15, 2010.
Add your own comment!
There is no comment yet.
|