Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Rad23a |
Protein FULL name:
UV excision repair protein RAD23 homolog A [Mus musculus].
Rad23a (Mus musculus) is product of expression of Rad23a gene.
FUNCTION: Involved in postreplication repair of UV-damaged DNA. Postreplication repair functions in gap-filling of a daughter strand on replication of damaged DNA (Potential).
SUBCELLULAR LOCATION: Nucleus (Probable).
PTM: Phosphorylated upon DNA damage, probably by ATM or ATR.
SIMILARITY: Belongs to the RAD23 family.
SIMILARITY: Contains 2 UBA domains.
SIMILARITY: Contains 1 ubiquitin-like domain.
| NCBI GenPept GI number(s): |
34447211 |
| Species: | Mus musculus |
Links to other databases:
| Database | ID | Link |
| Uniprot | P54726 |
P54726 |
| PFAM: | - |
P54726 (Link - using uniprot id) |
| InterPro: | - |
P54726 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MAVTITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIY AGKILSDDVPIKEYHIDEKNFVVVMVTKAKAGQGIPAPPEASPTAVPEPS TPFPPVLASGMSHPPPTSREDKSPSEESTTTTSPESISGSVPSSGSSGRE EDAASTLVTGSEYETMLTEIMSMGYERERVVAALRASYNNPHRAVEYLLT GIPGSPEPEHGSVQESQAPEQPATEAGENPLEFLRDQPQFQNMRQVIQQN PALLPALLQQLGQENPQLLQQISRHQEQFIQMLNEPPGELADISDVEGEV GAIGEEAPQMNYIQVTPQEKEAIERLKALGFPESLVIQAYFACEKNENLA ANFLLSQNFDDE |
Rad23a (Mus musculus) belongs to following protein families:
References:
| Title | Authors | Journal |
| Cloning, comparative mapping, and RNA expression of the mouse homologues of the Saccharomyces cerevisiae nucleotide excision repair gene RAD23. | van der Spek PJ, Visser CE, Hanaoka F, Smit B, Hagemeijer A, Bootsma D, Hoeijmakers JH | Genomics Feb. 1, 1996 |
| Large-scale phosphorylation analysis of mouse liver. | Villen J, Beausoleil SA, Gerber SA, Gygi SP | Proc Natl Acad Sci U S A Feb. 1, 2007 |
| ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. | Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ | Science May 25, 2007 |
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|