Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Mpg |
Protein FULL name:
N-methylpurine-DNA glycosylase [Mus musculus].
Mpg (Mus musculus) is product of expression of Mpg gene.
FUNCTION: Hydrolysis of the deoxyribose N-glycosidic bond to excise 3-methyladenine, and 7-methylguanine from the damaged DNA polymer formed by alkylation lesions.
CATALYTIC ACTIVITY: Hydrolysis of alkylated DNA, releasing 3- methyladenine, 3-methylguanine, 7-methylguanine and 7- methyladenine.
SUBUNIT: Binds MBD1 (By similarity).
SUBCELLULAR LOCATION: Nucleus (Potential).
SIMILARITY: Belongs to the DNA glycosylase MPG family.
| NCBI GenPept GI number(s): |
7106361 |
| Species: | Mus musculus |
Links to other databases:
| Database | ID | Link |
| Uniprot | Q04841 |
Q04841 |
| PFAM: | - |
Q04841 (Link - using uniprot id) |
| InterPro: | - |
Q04841 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MPARGGSARPGRGSLKPVSVTLLPDTEQPPFLGRARRPGNARAGSLVTGY HEVGQMPAPLSRKIGQKKQRLADSEQQQTPKERLLSTPGLRRSIYFSSPE DHSGRLGPEFFDQPAVTLARAFLGQVLVRRLADGTELRGRIVETEAYLGP EDEAAHSRGGRQTPRNRGMFMKPGTLYVYLIYGMYFCLNVSSQGAGACVL LRALEPLEGLETMRQLRNSLRKSTVGRSLKDRELCSGPSKLCQALAIDKS FDQRDLAQDDAVWLEHGPLESSSPAVVVAAARIGIGHAGEWTQKPLRFYV QGSPWVSVVDRVAEQMDQPQQTACSEGLLIVQK |
Mpg (Mus musculus) is able to recognize following damages:
Mpg (Mus musculus) belongs to following protein families:
References:
| Title | Authors | Journal |
| Homology of a 130-kb region enclosing the alpha-globin gene cluster, the alpha-locus controlling region, and two non-globin genes in human and mouse. | Kielman MF, Smits R, Devi TS, Fodde R, Bernini LF | Mamm Genome Jan. 1, 1993 |
| Cloning and characterization of a mouse 3-methyladenine/7-methyl-guanine/3-methylguanine DNA glycosylase cDNA whose gene maps to chromosome 11. | Engelward BP, Boosalis MS, Chen BJ, Deng Z, Siciliano MJ, Samson LD | Carcinogenesis Jan. 1, 1993 |
| Structural organization of the mouse DNA repair gene, N-methylpurine-DNA glycosylase. | Tatsuka M, Ibeanu GC, Izumi T, Narayan S, Ramana CV, Kim NK, Kang W, Roy G, Mitra S | DNA Cell Biol Feb. 1, 1995 |
| Structure of the mouse 3-methyladenine DNA glycosylase gene and exact localization upstream of the alpha-globin gene cluster on chromosome 11. | Kielman MF, Smits R, Bernini LF | Mamm Genome Aug. 1, 1995 |
| The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J | Genome Res Oct. 1, 2004 |
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|