Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Rad51p |
Rad51p is involved in:
HRR in Saccharomyces cerevisiae
- Interaction with homologous strand in Saccharomyces cerevisiae
- Polymerase Delta rebuilds missing fragment in Saccharomyces cerevisiae
- Polymerase Epsilon rebuilds missing fragment in Saccharomyces cerevisiae
- Homologous strands pairing in Saccharomyces cerevisiae
- Rad51 binds to ssDNA in Saccharomyces cerevisiae
- Strand exchange in Saccharomyces cerevisiae
FUNCTION: Required both for recombination and for the repair of DNA damage caused by X-rays. Its function may be modulated by interaction with other repair proteins. RAD52 interacts directly with RAD51, via its C-terminus. Forms a nucleoprotein filament with DNA as an early intermediate in recombination.
SUBUNIT: Part of a repair/recombination complex that includes RAD51, RAD52 and RAD54. Interacts with HED1, RDH54 and SAW1.
INTERACTION: Self; NbExp=2; IntAct=EBI-14709, EBI-14709; P32288:GLN1; NbExp=1; IntAct=EBI-14709, EBI-7665; P29295:HRR25; NbExp=1; IntAct=EBI-14709, EBI-8536; P38920:MLH1; NbExp=1; IntAct=EBI-14709, EBI-11003; P38953:RAD55; NbExp=1; IntAct=EBI-14709, EBI-14737;
SUBCELLULAR LOCATION: Nucleus. Note=Localizes as foci on meiotic chromosomes.
DEVELOPMENTAL STAGE: RAD51 is cell cycle regulated, peaking around the G1-to-S transition.
INDUCTION: By X-rays.
MISCELLANEOUS: Present with 6960 molecules/cell in log phase SD medium.
SIMILARITY: Belongs to the recA family. RAD51 subfamily.
SIMILARITY: Contains 1 HhH domain.
| NCBI GenPept GI number(s): |
4275 6320942 |
| Species: | Saccharomyces cerevisiae |
Links to other databases:
| Database | ID | Link |
| Uniprot | P25454 |
P25454 |
| PFAM: | - |
P25454 (Link - using uniprot id) |
| InterPro: |
IPR000445 IPR001553 IPR003593 IPR010995 IPR011941 IPR013632 |
IPR000445 IPR001553 IPR003593 IPR010995 IPR011941 IPR013632 |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | 1SZP |
1SZP |
Protein sequence:
|
MSQVQEQHISESQLQYGNGSLMSTVPADLSQSVVDGNGNGSSEDIEATNG SGDGGGLQEQAEAQGEMEDEAYDEAALGSFVPIEKLQVNGITMADVKKLR ESGLHTAEAVAYAPRKDLLEIKGISEAKADKLLNEAARLVPMGFVTAADF HMRRSELICLTTGSKNLDTLLGGGVETGSITELFGEFRTGKSQLCHTLAV TCQIPLDIGGGEGKCLYIDTEGTFRPVRLVSIAQRFGLDPDDALNNVAYA RAYNADHQLRLLDAAAQMMSESRFSLIVVDSVMALYRTDFSGRGELSARQ MHLAKFMRALQRLADQFGVAVVVTNQVVAQVDGGMAFNPDPKKPIGGNIM AHSSTTRLGFKKGKGCQRLCKVVDSPCLPEAECVFAIYEDGVGDPREEDE |
Rad51p (Saccharomyces cerevisiae) is able to recognize following damages:
Solved crystal structures:
References:
| Title | Authors | Journal |
| Rad51 protein involved in repair and recombination in S. cerevisiae is a RecA-like protein. | Shinohara A, Ogawa H, Ogawa T | Cell May 1, 1992 |
| Nucleotide sequence and transcriptional regulation of the yeast recombinational repair gene RAD51. | Basile G, Aker M, Mortimer RK | Mol Cell Biol July 1, 1992 |
| Semidominant suppressors of Srs2 helicase mutations of Saccharomyces cerevisiae map in the RAD51 gene, whose sequence predicts a protein with similarities to procaryotic RecA proteins. | Aboussekhra A, Chanet R, Adjiri A, Fabre F | Mol Cell Biol July 1, 1992 |
| The nucleotide sequence of Saccharomyces cerevisiae chromosome V. | Dietrich FS, Mulligan J, Hennessy K, Yelton MA, Allen E, Araujo R, Aviles E, Berno A, Brennan T, Carpenter J, Chen E, Cherry JM, Chung E, Duncan M, Guzman E, Hartzell G, Hunicke-Smith S, Hyman RW, Kayser A, Komp C, Lashkari D, Lew H, Lin D, Mosedale D, Davis RW, et al. | Nature May 1, 1997 |
| Catalysis of homologous DNA pairing by yeast Rad51 and Rad54 proteins. | Petukhova G, Stratton S, Sung P | Nature May 7, 1998 |
| Promotion of Rad51-dependent D-loop formation by yeast recombination factor Rdh54/Tid1. | Petukhova G, Sung P, Klein H | Genes Dev Sept. 1, 2000 |
| Global analysis of protein expression in yeast. | Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS | Nature Oct. 16, 2003 |
| Crystal structure of a Rad51 filament. | Conway AB, Lynch TW, Zhang Y, Fortin GS, Fung CW, Symington LS, Rice PA | Nat Struct Mol Biol Aug. 1, 2004 |
| Budding yeast Hed1 down-regulates the mitotic recombination machinery when meiotic recombination is impaired. | Tsubouchi H, Roeder GS | Genes Dev July 1, 2006 |
| Microarray-based genetic screen defines SAW1, a gene required for Rad1/Rad10-dependent processing of recombination intermediates. | Li F, Dong J, Pan X, Oum JH, Boeke JD, Lee SE | Mol Cell May 9, 2008 |
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|