|
|
Protein FULL name: period homolog 1 [Mus musculus].
Per1 (Mus musculus) is product of expression of
Per1
gene.
FUNCTION: Component of the circadian clock mechanism which is
essential for generating circadian rhythms. Negative element in
the circadian transcriptional loop. Influences CLOCK function by
interacting with other circadian regulatory proteins and
transporting them to the nucleus. Negatively regulates
CLOCK|NPAS2-BMAL1|BMAL2-induced transactivation.
SUBUNIT: Component of the circadian core oscillator, which
includes the CRY proteins, CLOCK or NPAS2, BMAL1 or BMAL2, CSNK1D
and/or CSNK1E, TIMELESS, and the PER proteins. Interacts directly
with TIMELESS, PER2, PER3 and, through a C-terminal domain, with
CRY1 and CRY2. Interaction with CSNK1D or CSNK1E promotes nuclear
location of PER proteins. Interacts with GPRASP1 (By similarity).
INTERACTION:
Q9R1X4:Timeless; NbExp=2; IntAct=EBI-1266764, EBI-1793117;
SUBCELLULAR LOCATION: Nucleus. Cytoplasm. Note=Mainly nuclear.
Nucleocytoplasmic shuttling is effected by interaction with other
circadian core oscillator proteins and/or by phosphorylation.
Retention of PER1 in the cytoplasm occurs through PER1-PER2
heterodimer formation or by interaction with CSNK1E and/or
phosphorylation which appears to mask the PER1 nuclear
localization signal. Also translocated to the nucleus by CRY1 or
CRY2.
TISSUE SPECIFICITY: In brain, highest expression is observed in
the SCN. Highly expressed in the pyramidal cell layer of the
piriform cortex, the periventricular part of the caudate-putamen,
many thalamic nuclei, and the granular layer of the cerebellar
cortex. Weaker expression is detected in most area of the brain,
including cortical and non cortical structures. Expression but no
oscillations occurs in the glomerular and mitral cell layers of
the olfactory bulb, the internal granular layer of the cerebellum,
the cornu ammonis and dentate gyrus of the hyppocampus, the
cerebral and piriform cortices. Also found in heart, brain,
spleen, lung, liver, skeletal muscle, testis. Highest level in
testis. Low level in kidney.
DEVELOPMENTAL STAGE: Expressed in the suprachiasmatic nucleus
(SCN) during late fetal and early neonatal life.
INDUCTION: In the suprachiasmatic nucleus (SCN), behaves like a
day-type oscillator, with maximum expression during the light
period. Oscillations are maintained under constant darkness and
are responsive to changes of the light/dark cycles. There is a 4
hour time delay between PER1 and PER2 oscillations. The expression
rhythms appear to originate from retina. In liver, peak levels at
CT9. In the SCN, levels increase by light exposure during
subjective night. Circadian oscillations also observed in skeletal
muscle and liver but not in testis.
PTM: Phosphorylated upon DNA damage, probably by ATM or ATR (By
similarity). Phosphorylated on serine residues by CSNK1E. Also can
be phosphorylated by the delta isoform. Phosphorylation by CSNK1
retains PER1 in the cytoplasm and leads to its ubiquitination and
subsequent degradation.
PTM: Ubiquitinated.
SIMILARITY: Contains 1 PAC (PAS-associated C-terminal) domain.
SIMILARITY: Contains 2 PAS (PER-ARNT-SIM) domains.
Links to other databases:
Protein sequence:
MSGPLEGADGGGDPRPGEPFCPGGVPSPGAPQHRPCPGPSLADDTDANSN
GSSGNESNGPESRGASQRSSHSSSSGNGKDSALLETTESSKSTNSQSPSP
PSSSIAYSLLSASSEQDNPSTSGCSSEQSARARTQKELMTALRELKLRLP
PERRGKGRSGTLATLQYALACVKQVQANQEYYQQWSLEEGEPCAMDMSTY
TLEELEHITSEYTLRNQDTFSVAVSFLTGRIVYISEQAGVLLRCKRDVFR
GARFSELLAPQDVGVFYGSTTPSRLPTWGTGTSAGSGLKDFTQEKSVFCR
IRGGPDRDPGPRYQPFRLTPYVTKIRVSDGAPAQPCCLLIAERIHSGYEA
PRIPPDKRIFTTRHTPSCLFQDVDERAAPLLGYLPQDLLGAPVLLFLHPE
DRPLMLAIHKKILQLAGQPFDHSPIRFCARNGEYVTMDTSWAGFVHPWSR
KVAFVLGRHKVRTAPLNEDVFTPPAPSPAPSLDSDIQELSEQIHRLLLQP
VHSSSPTGLCGVGPLMSPGPLHSPGSSSDSNGGDAEGPGPPAPVTFQQIC
KDVHLVKHQGQQLFIESRAKPPPRPRLLATGTFKAKVLPCQSPNPELEVA
PVPDQASLALAPEEPERKETSGCSYQQINCLDSILRYLESCNIPSTTKRK
CASSSSYTASSASDDDKQRAGPVPVGAKKDPSSAMLSGEGATPRKEPVVG
GTLSPLALANKAESVVSVTSQCSFSSTIVHVGDKKPPESDIIMMEDLPGL
APGPAPSPAPSPTVAPDPTPDAYRPVGLTKAVLSLHTQKEEQAFLNRFRD
LGRLRGLDTSSVAPSAPGCHHGPIPPGRRHHCRSKAKRSRHHHHQTPRPE
TPCYVSHPSPVPSSGPWPPPPATTPFPAMVQPYPLPVFSPRGGPQPLPPA
PTSVSPATFPSPLVTPMVALVLPNYLFPTPPSYPYGVSQAPVEGPPTPAS
HSPSPSLPPPPLSPPHRPDSPLFNSRCSSPLQLNLLQLEESPRTEGGAAA
GGPGSSAGPLPPSEETAEPEARLVEVTESSNQDALSGSSDLLELLLQEDS
RSGTGSAASGSLGSGLGSGSGSGSHEGGSTSASITRSSQSSHTSKYFGSI
DSSEAEAGAARARTEPGDQVIKCVLQDPIWLLMANADQRVMMTYQVPSRD
AASVLKQDRERLRAMQKQQPRFSEDQRRELGAVHSWVRKGQLPRALDVMA
CVDCGSSVQDPGHSDDPLFSELDGLGLEPMEEGGGEGGGCGVGGGGGDGG
EEAQTQIGAKGSSSQDSAMEEEEQGGGSSSPALPAEENSTS
|
Per1 (Mus musculus) is able to recognize following damages:
Per1 (Mus musculus) belongs to following protein families:
References:
|
Title
|
Authors
|
Journal
|
|
RIGUI, a putative mammalian ortholog of the Drosophila period gene.
|
Sun ZS, Albrecht U, Zhuchenko O, Bailey J, Eichele G, Lee CC
|
Cell
Sept. 19, 1997
|
|
Circadian oscillation of a mammalian homologue of the Drosophila period gene.
|
Tei H, Okamura H, Shigeyoshi Y, Fukuhara C, Ozawa R, Hirose M, Sakaki Y
|
Nature
Oct. 2, 1997
|
|
Two period homologs: circadian expression and photic regulation in the suprachiasmatic nuclei.
|
Shearman LP, Zylka MJ, Weaver DR, Kolakowski LF Jr, Reppert SM
|
Neuron
Dec. 1, 1997
|
|
Mammalian circadian autoregulatory loop: a timeless ortholog and mPer1 interact and negatively regulate CLOCK-BMAL1-induced transcription.
|
Sangoram AM, Saez L, Antoch MP, Gekakis N, Staknis D, Whiteley A, Fruechte EM, Vitaterna MH, Shimomura K, King DP, Young MW, Weitz CJ, Takahashi JS
|
Neuron
Nov. 1, 1998
|
|
A mammalian ortholog of Drosophila timeless, highly expressed in SCN and retina, forms a complex with mPER1.
|
Takumi T, Nagamine Y, Miyake S, Matsubara C, Taguchi K, Takekida S, Sakakida Y, Nishikawa K, Kishimoto T, Niwa S, Okumura K, Okamura H
|
Genes Cells
Feb. 1, 1999
|
|
mCRY1 and mCRY2 are essential components of the negative limb of the circadian clock feedback loop.
|
Kume K, Zylka MJ, Sriram S, Shearman LP, Weaver DR, Jin X, Maywood ES, Hastings MH, Reppert SM
|
Cell
July 23, 1999
|
|
Circadian regulation of cryptochrome genes in the mouse.
|
Miyamoto Y, Sancar A
|
Brain Res Mol Brain Res
Aug. 25, 1999
|
|
The human and mouse Period1 genes: five well-conserved E-boxes additively contribute to the enhancement of mPer1 transcription.
|
Hida A, Koike N, Hirose M, Hattori M, Sakaki Y, Tei H
|
Genomics
May 1, 2000
|
|
Nuclear entry of the circadian regulator mPER1 is controlled by mammalian casein kinase I epsilon.
|
Vielhaber E, Eide E, Rivers A, Gao ZH, Virshup DM
|
Mol Cell Biol
July 1, 2000
|
|
Nuclear export of mammalian PERIOD proteins.
|
Vielhaber EL, Duricka D, Ullman KS, Virshup DM
|
J Biol Chem
Dec. 7, 2001
|
|
Posttranslational mechanisms regulate the mammalian circadian clock.
|
Lee C, Etchegaray JP, Cagampang FR, Loudon AS, Reppert SM
|
Cell
Dec. 28, 2001
|
|
Control of intracellular dynamics of mammalian period proteins by casein kinase I epsilon (CKIepsilon) and CKIdelta in cultured cells.
|
Akashi M, Tsuchiya Y, Yoshino T, Nishida E
|
Mol Cell Biol
March 1, 2002
|
|
The circadian regulatory proteins BMAL1 and cryptochromes are substrates of casein kinase Iepsilon.
|
Eide EJ, Vielhaber EL, Hinz WA, Virshup DM
|
J Biol Chem
May 10, 2002
|
|
Direct association between mouse PERIOD and CKIepsilon is critical for a functioning circadian clock.
|
Lee C, Weaver DR, Reppert SM
|
Mol Cell Biol
Feb. 1, 2004
|
|
Identification of mPer1 phosphorylation sites responsible for the nuclear entry.
|
Takano A, Isojima Y, Nagai K
|
J Biol Chem
July 1, 2004
|
|
Functional evolution of the photolyase/cryptochrome protein family: importance of the C terminus of mammalian CRY1 for circadian core oscillator performance.
|
Chaves I, Yagita K, Barnhoorn S, Okamura H, van der Horst GT, Tamanini F
|
Mol Cell Biol
March 1, 2006
|
|
Casein kinase 1 delta regulates the pace of the mammalian circadian clock.
|
Etchegaray JP, Machida KK, Noton E, Constance CM, Dallmann R, Di Napoli MN, DeBruyne JP, Lambert CM, Yu EA, Reppert SM, Weaver DR
|
Mol Cell Biol
July 1, 2009
|
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|