Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Per1

Protein FULL name:

period homolog 1 [Mus musculus].


Per1 (Mus musculus) is product of expression of Per1 gene.






FUNCTION: Component of the circadian clock mechanism which is essential for generating circadian rhythms. Negative element in the circadian transcriptional loop. Influences CLOCK function by interacting with other circadian regulatory proteins and transporting them to the nucleus. Negatively regulates CLOCK|NPAS2-BMAL1|BMAL2-induced transactivation.

SUBUNIT: Component of the circadian core oscillator, which includes the CRY proteins, CLOCK or NPAS2, BMAL1 or BMAL2, CSNK1D and/or CSNK1E, TIMELESS, and the PER proteins. Interacts directly with TIMELESS, PER2, PER3 and, through a C-terminal domain, with CRY1 and CRY2. Interaction with CSNK1D or CSNK1E promotes nuclear location of PER proteins. Interacts with GPRASP1 (By similarity).

INTERACTION: Q9R1X4:Timeless; NbExp=2; IntAct=EBI-1266764, EBI-1793117;

SUBCELLULAR LOCATION: Nucleus. Cytoplasm. Note=Mainly nuclear. Nucleocytoplasmic shuttling is effected by interaction with other circadian core oscillator proteins and/or by phosphorylation. Retention of PER1 in the cytoplasm occurs through PER1-PER2 heterodimer formation or by interaction with CSNK1E and/or phosphorylation which appears to mask the PER1 nuclear localization signal. Also translocated to the nucleus by CRY1 or CRY2.

TISSUE SPECIFICITY: In brain, highest expression is observed in the SCN. Highly expressed in the pyramidal cell layer of the piriform cortex, the periventricular part of the caudate-putamen, many thalamic nuclei, and the granular layer of the cerebellar cortex. Weaker expression is detected in most area of the brain, including cortical and non cortical structures. Expression but no oscillations occurs in the glomerular and mitral cell layers of the olfactory bulb, the internal granular layer of the cerebellum, the cornu ammonis and dentate gyrus of the hyppocampus, the cerebral and piriform cortices. Also found in heart, brain, spleen, lung, liver, skeletal muscle, testis. Highest level in testis. Low level in kidney.

DEVELOPMENTAL STAGE: Expressed in the suprachiasmatic nucleus (SCN) during late fetal and early neonatal life.

INDUCTION: In the suprachiasmatic nucleus (SCN), behaves like a day-type oscillator, with maximum expression during the light period. Oscillations are maintained under constant darkness and are responsive to changes of the light/dark cycles. There is a 4 hour time delay between PER1 and PER2 oscillations. The expression rhythms appear to originate from retina. In liver, peak levels at CT9. In the SCN, levels increase by light exposure during subjective night. Circadian oscillations also observed in skeletal muscle and liver but not in testis.

PTM: Phosphorylated upon DNA damage, probably by ATM or ATR (By similarity). Phosphorylated on serine residues by CSNK1E. Also can be phosphorylated by the delta isoform. Phosphorylation by CSNK1 retains PER1 in the cytoplasm and leads to its ubiquitination and subsequent degradation.

PTM: Ubiquitinated.

SIMILARITY: Contains 1 PAC (PAS-associated C-terminal) domain.

SIMILARITY: Contains 2 PAS (PER-ARNT-SIM) domains.


NCBI GenPept GI number(s): 6755032
Species: Mus musculus

Links to other databases:

Database ID Link
Uniprot O35973 O35973
PFAM: - O35973 (Link - using uniprot id)
InterPro: - O35973 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MSGPLEGADGGGDPRPGEPFCPGGVPSPGAPQHRPCPGPSLADDTDANSN
GSSGNESNGPESRGASQRSSHSSSSGNGKDSALLETTESSKSTNSQSPSP
PSSSIAYSLLSASSEQDNPSTSGCSSEQSARARTQKELMTALRELKLRLP
PERRGKGRSGTLATLQYALACVKQVQANQEYYQQWSLEEGEPCAMDMSTY
TLEELEHITSEYTLRNQDTFSVAVSFLTGRIVYISEQAGVLLRCKRDVFR
GARFSELLAPQDVGVFYGSTTPSRLPTWGTGTSAGSGLKDFTQEKSVFCR
IRGGPDRDPGPRYQPFRLTPYVTKIRVSDGAPAQPCCLLIAERIHSGYEA
PRIPPDKRIFTTRHTPSCLFQDVDERAAPLLGYLPQDLLGAPVLLFLHPE
DRPLMLAIHKKILQLAGQPFDHSPIRFCARNGEYVTMDTSWAGFVHPWSR
KVAFVLGRHKVRTAPLNEDVFTPPAPSPAPSLDSDIQELSEQIHRLLLQP
VHSSSPTGLCGVGPLMSPGPLHSPGSSSDSNGGDAEGPGPPAPVTFQQIC
KDVHLVKHQGQQLFIESRAKPPPRPRLLATGTFKAKVLPCQSPNPELEVA
PVPDQASLALAPEEPERKETSGCSYQQINCLDSILRYLESCNIPSTTKRK
CASSSSYTASSASDDDKQRAGPVPVGAKKDPSSAMLSGEGATPRKEPVVG
GTLSPLALANKAESVVSVTSQCSFSSTIVHVGDKKPPESDIIMMEDLPGL
APGPAPSPAPSPTVAPDPTPDAYRPVGLTKAVLSLHTQKEEQAFLNRFRD
LGRLRGLDTSSVAPSAPGCHHGPIPPGRRHHCRSKAKRSRHHHHQTPRPE
TPCYVSHPSPVPSSGPWPPPPATTPFPAMVQPYPLPVFSPRGGPQPLPPA
PTSVSPATFPSPLVTPMVALVLPNYLFPTPPSYPYGVSQAPVEGPPTPAS
HSPSPSLPPPPLSPPHRPDSPLFNSRCSSPLQLNLLQLEESPRTEGGAAA
GGPGSSAGPLPPSEETAEPEARLVEVTESSNQDALSGSSDLLELLLQEDS
RSGTGSAASGSLGSGLGSGSGSGSHEGGSTSASITRSSQSSHTSKYFGSI
DSSEAEAGAARARTEPGDQVIKCVLQDPIWLLMANADQRVMMTYQVPSRD
AASVLKQDRERLRAMQKQQPRFSEDQRRELGAVHSWVRKGQLPRALDVMA
CVDCGSSVQDPGHSDDPLFSELDGLGLEPMEEGGGEGGGCGVGGGGGDGG
EEAQTQIGAKGSSSQDSAMEEEEQGGGSSSPALPAEENSTS

Per1 (Mus musculus) is able to recognize following damages:
Per1 (Mus musculus) belongs to following protein families:
References:

Title Authors Journal
RIGUI, a putative mammalian ortholog of the Drosophila period gene. Sun ZS, Albrecht U, Zhuchenko O, Bailey J, Eichele G, Lee CC Cell Sept. 19, 1997
Circadian oscillation of a mammalian homologue of the Drosophila period gene. Tei H, Okamura H, Shigeyoshi Y, Fukuhara C, Ozawa R, Hirose M, Sakaki Y Nature Oct. 2, 1997
Two period homologs: circadian expression and photic regulation in the suprachiasmatic nuclei. Shearman LP, Zylka MJ, Weaver DR, Kolakowski LF Jr, Reppert SM Neuron Dec. 1, 1997
Mammalian circadian autoregulatory loop: a timeless ortholog and mPer1 interact and negatively regulate CLOCK-BMAL1-induced transcription. Sangoram AM, Saez L, Antoch MP, Gekakis N, Staknis D, Whiteley A, Fruechte EM, Vitaterna MH, Shimomura K, King DP, Young MW, Weitz CJ, Takahashi JS Neuron Nov. 1, 1998
A mammalian ortholog of Drosophila timeless, highly expressed in SCN and retina, forms a complex with mPER1. Takumi T, Nagamine Y, Miyake S, Matsubara C, Taguchi K, Takekida S, Sakakida Y, Nishikawa K, Kishimoto T, Niwa S, Okumura K, Okamura H Genes Cells Feb. 1, 1999
mCRY1 and mCRY2 are essential components of the negative limb of the circadian clock feedback loop. Kume K, Zylka MJ, Sriram S, Shearman LP, Weaver DR, Jin X, Maywood ES, Hastings MH, Reppert SM Cell July 23, 1999
Circadian regulation of cryptochrome genes in the mouse. Miyamoto Y, Sancar A Brain Res Mol Brain Res Aug. 25, 1999
The human and mouse Period1 genes: five well-conserved E-boxes additively contribute to the enhancement of mPer1 transcription. Hida A, Koike N, Hirose M, Hattori M, Sakaki Y, Tei H Genomics May 1, 2000
Nuclear entry of the circadian regulator mPER1 is controlled by mammalian casein kinase I epsilon. Vielhaber E, Eide E, Rivers A, Gao ZH, Virshup DM Mol Cell Biol July 1, 2000
Nuclear export of mammalian PERIOD proteins. Vielhaber EL, Duricka D, Ullman KS, Virshup DM J Biol Chem Dec. 7, 2001
Posttranslational mechanisms regulate the mammalian circadian clock. Lee C, Etchegaray JP, Cagampang FR, Loudon AS, Reppert SM Cell Dec. 28, 2001
Control of intracellular dynamics of mammalian period proteins by casein kinase I epsilon (CKIepsilon) and CKIdelta in cultured cells. Akashi M, Tsuchiya Y, Yoshino T, Nishida E Mol Cell Biol March 1, 2002
The circadian regulatory proteins BMAL1 and cryptochromes are substrates of casein kinase Iepsilon. Eide EJ, Vielhaber EL, Hinz WA, Virshup DM J Biol Chem May 10, 2002
Direct association between mouse PERIOD and CKIepsilon is critical for a functioning circadian clock. Lee C, Weaver DR, Reppert SM Mol Cell Biol Feb. 1, 2004
Identification of mPer1 phosphorylation sites responsible for the nuclear entry. Takano A, Isojima Y, Nagai K J Biol Chem July 1, 2004
Functional evolution of the photolyase/cryptochrome protein family: importance of the C terminus of mammalian CRY1 for circadian core oscillator performance. Chaves I, Yagita K, Barnhoorn S, Okamura H, van der Horst GT, Tamanini F Mol Cell Biol March 1, 2006
Casein kinase 1 delta regulates the pace of the mammalian circadian clock. Etchegaray JP, Machida KK, Noton E, Constance CM, Dallmann R, Di Napoli MN, DeBruyne JP, Lambert CM, Yu EA, Reppert SM, Weaver DR Mol Cell Biol July 1, 2009


Last modification of this entry: Oct. 6, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.