REPAIRtoire - a database of DNA repair pathways

Welcome! Click here to login or here to register.

Home

Bujnicki Lab Homepage

Rad54p

Rad54p (Saccharomyces cerevisiae) is product of expression of RAD54 gene.

Rad54p is involved in:

HRR in Saccharomyces cerevisiae

Strand exchange in Saccharomyces cerevisiae

FUNCTION: Involved in DNA repair and mitotic recombination. Functions in the recombinational DNA repair (RAD52) pathway. Dissociates RAD51 from nucleoprotein filaments formed on dsDNA. Could be involved in the turnover of RAD51 protein-dsDNA filaments. Addition of RAD54 overcomes inhibition of DNA strand exchange by RAD51 bound to substrate dsDNA. Species preference in the RAD51 dissociation and DNA strand exchange assays underlines the importance of specific RAD54-RAD51 interactions. RAD51 is unable to release dsDNA upon ATP hydrolysis, leaving it stuck on the heteroduplex DNA product after DNA strand exchange.

SUBUNIT: Interacts with RAD51.

INTERACTION: P36156:ECM4; NbExp=1; IntAct=EBI-14728, EBI-2042717;

SUBCELLULAR LOCATION: Nucleus.

INDUCTION: Expression increases in late G1 phase compared to other phases of the cell cycle.

SIMILARITY: Belongs to the SNF2/RAD54 helicase family.

SIMILARITY: Contains 1 helicase ATP-binding domain.

SIMILARITY: Contains 1 helicase C-terminal domain.

NCBI GenPept GI number(s):	728692
Species:	Saccharomyces cerevisiae

Links to other databases:

Database	ID	Link
Uniprot	P32863	P32863
PFAM:	-	P32863 (Link - using uniprot id)
InterPro:	IPR000330 IPR001650 IPR011545	IPR000330 IPR001650 IPR011545
CATH:	-	-
SCOP:	-	-
PDB:	-	-

Protein sequence:

MARRRLPDRPPNGIGAGERPRLVPRPINVQDSVNRLTKPFRVPYKNTHIP
PAAGRIATGSDNIVGGRSLRKRSATVCYSGLDINADEAEYNSQDISFSQL
TKRRKDALSAQRLAKDPTRLSHIQYTLRRSFTVPIKGYVQRHSLPLTLGM
KKKITPEPRPLHDPTDEFAIVLYDPSVDGEMIVHDTSMDNKEEESKKMIK
STQEKDNINKEKNSQEERPTQRIGRHPALMTNGVRNKPLRELLGDSENSA
ENKKKFASVPVVIDPKLAKILRPHQVEGVRFLYRCVTGLVMKDYLEAEAF
NTSSEDPLKSDEKALTESQKTEQNNRGAYGCIMADEMGLGKTLQCIALMW
TLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWLGPNTLTPLAVDGKK
SSMGGGNTTVSQAIHAWAQAQGRNIVKPVLIISYETLRRNVDQLKNCNVG
LMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLSF
SNPGLLGSRAEFRKNFENPILRGRDADATDKEITKGEAQLQKLSTIVSKF
IIRRTNDILAKYLPCKYEHVIFVNLKPLQNELYNKLIKSREVKKVVKGVG
GSQPLRAIGILKKLCNHPNLLNFEDEFDDEDDLELPDDYNMPGSKARDVQ
TKYSAKFSILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRYKHYSAV
RLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILM
DPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKMSL
SSCVVDAKEDVERLFSSDNLRQLFQKNENTICETHETYHCKRCNAQGKQL
KRAPAMLYGDATTWNHLNHDALEKTNDHLLKNEHHYNDISFAFQYISH

References:

Title	Authors	Journal
Sequence of RAD54, a Saccharomyces cerevisiae gene involved in recombination and repair.	Emery HS, Schild D, Kellogg DE, Mortimer RK	Gene July 31, 1991
The DNA repair genes RAD54 and UNG1 are cell cycle regulated in budding yeast but MCB promoter elements have no essential role in the DNA damage response.	Johnston LH, Johnson AL	Nucleic Acids Res June 25, 1995
DNA sequence analysis of a 35 kb segment from Saccharomyces cerevisiae chromosome VII reveals 19 open reading frames including RAD54, ACE1/CUP2, PMR1, RCK1, AMS1 and CAL1/CDC43.	James CM, Indge KJ, Oliver SG	Yeast Nov. 1, 1995
The nucleotide sequence of Saccharomyces cerevisiae chromosome VII.	Tettelin H, Agostoni Carbone ML, Albermann K, Albers M, Arroyo J, Backes U, Barreiros T, Bertani I, Bjourson AJ, Bruckner M, Bruschi CV, Carignani G, Castagnoli L, Cerdan E, Clemente ML, Coblenz A, Coglievina M, Coissac E, Defoor E, Del Bino S, Delius H, Delneri D, de Wergifosse P, Dujon B, Kleine K, et al.	Nature May 1, 1997
Catalysis of homologous DNA pairing by yeast Rad51 and Rad54 proteins.	Petukhova G, Stratton S, Sung P	Nature May 7, 1998
Rad54, a Swi2/Snf2-like recombinational repair protein, disassembles Rad51:dsDNA filaments.	Solinger JA, Kiianitsa K, Heyer WD	Mol Cell Nov. 1, 2002
Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases.	Smolka MB, Albuquerque CP, Chen SH, Zhou H	Proc Natl Acad Sci U S A June 19, 2007
A multidimensional chromatography technology for in-depth phosphoproteome analysis.	Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H	Mol Cell Proteomics July 1, 2008

Last modification of this entry: Oct. 6, 2010.

Add your own comment!

There is no comment yet.

Welcome stranger! Click here to login or here to register.