|
|
Protein FULL name: DNA repair protein XRCC4 [Mus musculus].
Xrcc4 (Mus musculus) is product of expression of
Xrcc4
gene.
FUNCTION: Involved in DNA nonhomologous end joining (NHEJ)
required for double-strand break repair and V(D)J recombination.
Binds to DNA and to DNA ligase IV (LIG4). The LIG4-XRCC4 complex
is responsible for the NHEJ ligation step, and XRCC4 enhances the
joining activity of LIG4. Binding of the LIG4-XRCC4 complex to DNA
ends is dependent on the assembly of the DNA-dependent protein
kinase complex DNA-PK to these DNA ends (By similarity).
SUBUNIT: Homodimer and homotetramer in solution. The homodimer
associates with LIG4, and the LIG4-XRCC4 complex associates in a
DNA-dependent manner with the DNA-PK complex formed by the Ku
p70/p86 dimer (G22P1/G22P2) and PRKDC. Seems to interact directly
with PRKDC but not with the Ku p70/86 dimer. Interacts with
XLF/Cernunnos. Interacts with APTX and APLF (By similarity).
SUBCELLULAR LOCATION: Nucleus (By similarity).
PTM: Phosphorylation by CK2 promotes interaction with APTX (By
similarity).
PTM: Monoubiquitinated (By similarity).
DISRUPTION PHENOTYPE: Mice show growth defects, premature
senescence, IR sensitivity, and inability to support V(D)J
recombination. XRCC4 deficiency causes late embryonic lethality
accompanied by defective lymphogenesis and defective neurogenesis
manifested by extensive apoptotic death of newly generated
postmitotic neuronal cells.
SIMILARITY: Belongs to the XRCC4 family.
Links to other databases:
Protein sequence:
MERKVSRIYLASEPNVPYFLQVSWERTIGSGFVITLTDGHSAWTATVSEL
EISQEADDMAMEKGKYIDELRKALVPGSGAAGTYKFLFSKESRHFSLEKE
LKDVSFRLGSFNLDKVSNSAEVIRDLICYCLDTITEKQAKNEHLQKENER
LLRDWNDVQGRFEKCVSAKEALEADLYQRFILVLNEKKTKIRSLHKLLNE
VQQLEESTKPERENPCSDKTPEEHGLYDGSTDEESGAPVQAAETLHKDDS
IFSSPDVTDIAPSRKRRHRMQKNLGTEPKMAPQELPLQEKERLASSLPQT
LKEESTSAENMSLETLRNSSPEDLFD
|
Xrcc4 (Mus musculus) belongs to following protein families:
References:
|
Title
|
Authors
|
Journal
|
|
A critical role for DNA end-joining proteins in both lymphogenesis and neurogenesis.
|
Gao Y, Sun Y, Frank KM, Dikkes P, Fujiwara Y, Seidl KJ, Sekiguchi JM, Rathbun GA, Swat W, Wang J, Bronson RT, Malynn BA, Bryans M, Zhu C, Chaudhuri J, Davidson L, Ferrini R, Stamato T, Orkin SH, Greenberg ME, Alt FW
|
Cell
Dec. 23, 1998
|
|
Molecular characterization of ionizing radiation-hypersensitive mutant M10 cells.
|
Mori M, Itsukaichi H, Nakamura A, Sato K
|
Mutat Res
Dec. 19, 2001
|
|
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
|
Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J
|
Genome Res
Oct. 1, 2004
|
|
The transcriptional landscape of the mammalian genome.
|
Carninci P, Kasukawa T, Katayama S, Gough J, Frith MC, Maeda N, Oyama R, Ravasi T, Lenhard B, Wells C, Kodzius R, Shimokawa K, Bajic VB, Brenner SE, Batalov S, Forrest AR, Zavolan M, Davis MJ, Wilming LG, Aidinis V, Allen JE, Ambesi-Impiombato A, Apweiler R, Aturaliya RN, Bailey TL, Bansal M, Baxter L, Beisel KW, Bersano T, Bono H, Chalk AM, Chiu KP, Choudhary V, Christoffels A, Clutterbuck DR, Crowe ML, Dalla E, Dalrymple BP, de Bono B, Della Gatta G, di Bernardo D, Down T, Engstrom P, Fagiolini M, Faulkner G, Fletcher CF, Fukushima T, Furuno M, Futaki S, Gariboldi M, Georgii-Hemming P, Gingeras TR, Gojobori T, Green RE, Gustincich S, Harbers M, Hayashi Y, Hensch TK, Hirokawa N, Hill D, Huminiecki L, Iacono M, Ikeo K, Iwama A, Ishikawa T, Jakt M, Kanapin A, Katoh M, Kawasawa Y, Kelso J, Kitamura H, Kitano H, Kollias G, Krishnan SP, Kruger A, Kummerfeld SK, Kurochkin IV, Lareau LF, Lazarevic D, Lipovich L, Liu J, Liuni S, McWilliam S, Madan Babu M, Madera M, Marchionni L, Matsuda H, Matsuzawa S, Miki H, Mignone F, Miyake S, Morris K, Mottagui-Tabar S, Mulder N, Nakano N, Nakauchi H, Ng P, Nilsson R, Nishiguchi S, Nishikawa S, Nori F, Ohara O, Okazaki Y, Orlando V, Pang KC, Pavan WJ, Pavesi G, Pesole G, Petrovsky N, Piazza S, Reed J, Reid JF, Ring BZ, Ringwald M, Rost B, Ruan Y, Salzberg SL, Sandelin A, Schneider C, Schonbach C, Sekiguchi K, Semple CA, Seno S, Sessa L, Sheng Y, Shibata Y, Shimada H, Shimada K, Silva D, Sinclair B, Sperling S, Stupka E, Sugiura K, Sultana R, Takenaka Y, Taki K, Tammoja K, Tan SL, Tang S, Taylor MS, Tegner J, Teichmann SA, Ueda HR, van Nimwegen E, Verardo R, Wei CL, Yagi K, Yamanishi H, Zabarovsky E, Zhu S, Zimmer A, Hide W, Bult C, Grimmond SM, Teasdale RD, Liu ET, Brusic V, Quackenbush J, Wahlestedt C, Mattick JS, Hume DA, Kai C, Sasaki D, Tomaru Y, Fukuda S, Kanamori-Katayama M, Suzuki M, Aoki J, Arakawa T, Iida J, Imamura K, Itoh M, Kato T, Kawaji H, Kawagashira N, Kawashima T, Kojima M, Kondo S, Konno H, Nakano K, Ninomiya N, Nishio T, Okada M, Plessy C, Shibata K, Shiraki T, Suzuki S, Tagami M, Waki K, Watahiki A, Okamura-Oho Y, Suzuki H, Kawai J, Hayashizaki Y
|
Science
Sept. 2, 2005
|
|
Solid tumor proteome and phosphoproteome analysis by high resolution mass spectrometry.
|
Zanivan S, Gnad F, Wickstrom SA, Geiger T, Macek B, Cox J, Fassler R, Mann M
|
J Proteome Res
Dec. 1, 2008
|
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|