Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Rad17

Protein FULL name:

cell cycle checkpoint protein RAD17 [Mus musculus].


Rad17 (Mus musculus) is product of expression of Rad17 gene.






FUNCTION: Essential for sustained cell growth, maintenance of chromosomal stability, and ATR-dependent checkpoint activation upon DNA damage. Has a weak ATPase activity required for binding to chromatin. Participates in the recruitment of the RAD1-RAD9- HUS1 complex onto chromatin, and in CHEK1 activation. May also serve as a sensor of DNA replication progression, and may be involved in homologous recombination (By similarity). Essential for embryonic development. May be involved in homologous recombination.

SUBUNIT: Part of a DNA-binding complex containing RFC2, RFC3, RFC4 and RFC5. Interacts with RAD1 and RAD9 within the RAD1-RAD9-HUS1 complex. Interacts with RAD9B, POLE, NHP2L1 and MCM7. DNA damage promotes interaction with ATR or ATM and disrupts interaction with the RAD1-RAD9-HUS1 complex (By similarity).

SUBCELLULAR LOCATION: Nucleus (By similarity). Note=Phosphorylated form redistributes to discrete nuclear foci upon DNA damage (By similarity).

TISSUE SPECIFICITY: Ubiquitous at low levels. Highly expressed in testis, where it is expressed in spermatogonia, spermatocytes and spermatids, but absent in mature spermatozoa (at protein level).

PTM: Phosphorylated. Phosphorylation on Ser-647 and Ser-657 is cell cycle-regulated, enhanced by genotoxic stress, and required for activation of checkpoint signaling.

DISRUPTION PHENOTYPE: Mice show numerous defects in embryonic development, starting at E8.5.

SIMILARITY: Belongs to the rad17/RAD24 family.


NCBI GenPept GI number(s): 113199779
Species: Mus musculus

Links to other databases:

Database ID Link
Uniprot Q6NXW6 Q6NXW6
PFAM: - Q6NXW6 (Link - using uniprot id)
InterPro: - Q6NXW6 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MSETFLRPKVSSTKVTDWVAPAFDDFEANTAITTITASSLTFSNSSHRRK
YLPSTLESNRLSARKRGRLSLEQTHGLETSRERLSDNEPWVDKYKPETQH
ELAVHKKKIEEVETWLKAQVLEVKPKQGGSVLLITGPPGCGKTTTIKILS
KELGIQVQEWVNPILPDFQKDDYKELLSLESNFSVVPYQSQIAVFNDFLL
RATKYSKLQMLGDDLTTDKKIILVEELPNQFYRDPNALHEILRKHVQIGR
CPLVFIVSDSVSGDNNQRLLFPRNIQEECSVSNISFNPVAPTIMMKFLNR
IVTIEASKNGEKIIVPNKTSLELLCQGCSGDIRSAINSLQFSSSKGENSS
WSKKKRMSLKSDAAISKSKQKKKHNSTLENQEIQAIGGKDVSLFLFRALG
KILYCKRAPLTELDSPRLPAHLSEHDRDTLLVQPEEIVEMSHMPGDFFNL
YLHQNYIDFFAEVDDLVPASEFLSFADILGGDWNTRSLLREYSTSVATRG
VMHSNKARGFAHCQGGSSFRPLHKPQWFLIQKKYRENCLAAKALFVDFCL
PALCLQTQLLPYLALLTIPMRNKAQISFIQDVGRLPLKRSFGRLKMEALT
DRELGLIDPDSGDESPHSGGQPAQEAPGEPAQAAQNADPETWSLPLSQNS
GSDLPASQPQPFSSKVDMEEEEEEEEDIIIEDYDSEET

Rad17 (Mus musculus) belongs to following protein families:
References:

Title Authors Journal
Human and mouse RAD17 genes: identification, localization, genomic structure and histological expression pattern in normal testis and seminoma. von Deimling F, Scharf JM, Liehr T, Rothe M, Kelter AR, Albers P, Dietrich WF, Kunkel LM, Wernert N, Wirth B Hum Genet Jan. 1, 1999
Human and mouse homologs of the Schizosaccharomyces pombe rad17+ cell cycle checkpoint control gene. Bluyssen HA, Naus NC, van Os RI, Jaspers I, Hoeijmakers JH, de Klein A Genomics Feb. 15, 1999
HRad17, a human homologue of the Schizosaccharomyces pombe checkpoint gene rad17, is overexpressed in colon carcinoma. Bao S, Chang MS, Auclair D, Sun Y, Wang Y, Wong WK, Zhang J, Liu Y, Qian X, Sutherland R, Magi-Galluzi C, Weisberg E, Cheng EY, Hao L, Sasaki H, Campbell MS, Kraeft SK, Loda M, Lo KM, Chen LB Cancer Res May 1, 1999
Phosphorylation of serines 635 and 645 of human Rad17 is cell cycle regulated and is required for G(1)/S checkpoint activation in response to DNA damage. Post S, Weng YC, Cimprich K, Chen LB, Xu Y, Lee EY Proc Natl Acad Sci U S A Nov. 6, 2001
The human checkpoint Rad protein Rad17 is chromatin-associated throughout the cell cycle, localizes to DNA replication sites, and interacts with DNA polymerase epsilon. Post SM, Tomkinson AE, Lee EY Nucleic Acids Res Oct. 1, 2003
Mutation of the mouse Rad17 gene leads to embryonic lethality and reveals a role in DNA damage-dependent recombination. Budzowska M, Jaspers I, Essers J, de Waard H, van Drunen E, Hanada K, Beverloo B, Hendriks RW, de Klein A, Kanaar R, Hoeijmakers JH, Maas A EMBO J Sept. 1, 2004
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J Genome Res Oct. 1, 2004


Last modification of this entry: Oct. 6, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.