Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Polk |
Protein FULL name:
DNA polymerase kappa [Mus musculus].
Polk (Mus musculus) is product of expression of Polk gene.
FUNCTION: DNA polymerase specifically involved in DNA repair. Plays an important role in translesion synthesis, where the normal high-fidelity DNA polymerases cannot proceed and DNA synthesis stalls. Depending on the context, it inserts the correct base, but causes frequent base transitions, transversions and frameshifts. Lacks 3'-5' proofreading exonuclease activity. Forms a Schiff base with 5'-deoxyribose phosphate at abasic sites, but does not have lyase activity (By similarity).
CATALYTIC ACTIVITY: Deoxynucleoside triphosphate + DNA(n) = diphosphate + DNA(n+1).
COFACTOR: Divalent metal cations. Prefers magnesium, but can also use manganese (By similarity).
SUBUNIT: Binds PCNA (By similarity). Binds REV1L.
SUBCELLULAR LOCATION: Nucleus (By similarity). Note=Detected throughout the nucleus and at replication foci (By similarity).
TISSUE SPECIFICITY: Detected at low levels in heart, brain, lung, liver, kidney and testis.
DOMAIN: The catalytic core consists of fingers, palm and thumb subdomains, but the fingers and thumb subdomains are much smaller than in high-fidelity polymerases; residues from five sequence motifs of the Y-family cluster around an active site cleft that can accommodate DNA and nucleotide substrates with relaxed geometric constraints, with consequently higher rates of misincorporation and low processivity.
SIMILARITY: Belongs to the DNA polymerase type-Y family.
SIMILARITY: Contains 2 Rad18-type zinc fingers.
SIMILARITY: Contains 1 umuC domain.
| NCBI GenPept GI number(s): |
6753636 |
| Species: | Mus musculus |
Links to other databases:
| Database | ID | Link |
| Uniprot | Q9QUG2 |
Q9QUG2 |
| PFAM: | - |
Q9QUG2 (Link - using uniprot id) |
| InterPro: | - |
Q9QUG2 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MDNTKEKDNFKDDLLLRMGLNDNKAGMEGLDKEKINKIIMEATKGSRFYG NELKKEKQVNQRIENMMQQKAQITSQQLRKAQLQVDKFAMELERNRNLNN TIVHVDMDAFYAAVEMRDNPELKDKPIAVGSMSMLATSNYHARRFGVRAA MPGFIAKRLCPQLIIVPPNFDKYRAVSKEVKEILAEYDPNFMAMSLDEAY LNITQHLQERQDWPEDKRRYFIKMGNYLKIDTPRQEANELTEYERSISPL LFEDSPPDLQPQGSPFQLNSEEQNNPQIAQNSVVFGTSAEEVVKEIRFRI EQKTTLTASAGIAPNTMLAKVCSDKNKPNGQYQILPSRSAVMDFIKDLPI RKVSGIGKVTEKMLMALGIVTCTELYQQRALLSLLFSETSWHYFLHIALG LGSTDLARDGERKSMSVERTFSEISKTEEQYSLCQELCAELAHDLQKEGL KGRTVTIKLKNVNFEVKTRASTVPAAISTAEEIFAIAKELLRTEVNVGSP HPLRLRLMGVRMSTFSSEDDRKHQQRSIIGFLQAGNQALSSTGDSLDKTD KTELAKPLEMSHKKSFFDKKRSERISNCQDTSRCKTAGQQALQILEPSQA LKKLSESFETSENSNDCQTFICPVCFREQEGVSLEAFNEHVDECLDGPST SENSKISCYSHASSADIGQKEDVHPSIPLCEKRGHENGEITLVDGVDLTG TEDRSLKAARMDTLENNRSKEECPDIPDKSCPISLENETISTLSRQDSVQ PCTDEVVTGRALVCPVCNLEQETSDLTLFNIHVDICLNKGIIQELRNSEG NSVKQPKESSRSTDRLQKASGRTKRPGTKTKSSTLKKTKPRDPRHTLDGF FK |
Polk (Mus musculus) is able to recognize following damages:
Polk (Mus musculus) belongs to following protein families:
References:
| Title | Authors | Journal |
| Human and mouse homologs of Escherichia coli DinB (DNA polymerase IV), members of the UmuC/DinB superfamily. | Gerlach VL, Aravind L, Gotway G, Schultz RA, Koonin EV, Friedberg EC | Proc Natl Acad Sci U S A Oct. 12, 1999 |
| Mutation enhancement by DINB1, a mammalian homologue of the Escherichia coli mutagenesis protein dinB. | Ogi T, Kato T Jr, Kato T, Ohmori H | Genes Cells Nov. 1, 1999 |
| Polkappa protects mammalian cells against the lethal and mutagenic effects of benzo[a]pyrene. | Ogi T, Shinkai Y, Tanaka K, Ohmori H | Proc Natl Acad Sci U S A Nov. 26, 2002 |
| Mouse Rev1 protein interacts with multiple DNA polymerases involved in translesion DNA synthesis. | Guo C, Fischhaber PL, Luk-Paszyc MJ, Masuda Y, Zhou J, Kamiya K, Kisker C, Friedberg EC | EMBO J Dec. 15, 2003 |
| The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J | Genome Res Oct. 1, 2004 |
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|