|
|
Protein FULL name: cell cycle checkpoint protein RAD1 [Mus musculus].
Rad1 (Mus musculus) is product of expression of
Rad1
gene.
FUNCTION: Component of the 9-1-1 cell-cycle checkpoint response
complex that plays a major role in DNA repair. The 9-1-1 complex
is recruited to DNA lesion upon damage by the RAD17-replication
factor C (RFC) clamp loader complex. Acts then as a sliding clamp
platform on DNA for several proteins involved in long-patch base
excision repair (LP-BER). The 9-1-1 complex stimulates DNA
polymerase beta (POLB) activity by increasing its affinity for the
3'-OH end of the primer-template and stabilizes POLB to those
sites where LP-BER proceeds; endonuclease FEN1 cleavage activity
on substrates with double, nick, or gap flaps of distinct
sequences and lengths; and DNA ligase I (LIG1) on long-patch base
excision repair substrates. Isoform 1 possesses 3'->5' double
stranded DNA exonuclease activity (By similarity).
CATALYTIC ACTIVITY: Exonucleolytic cleavage in the 3'- to 5'-
direction to yield nucleoside 5'-phosphates.
SUBUNIT: Component of the toroidal 9-1-1 (RAD9-RAD1-HUS1) complex,
composed of RAD9A, RAD1 and HUS1. The 9-1-1 complex associates
with LIG1, POLB, FEN1, RAD17, HDAC1, RPA1 and RPA2. The 9-1-1
complex associates with the RAD17-RFC complex. RAD1 interacts with
POLB, FEN1, HUS1, HUS1B, RAD9A and RAD9B. Interacts with DNAJC7
(By similarity).
SUBCELLULAR LOCATION: Nucleus (By similarity).
TISSUE SPECIFICITY: Expressed in testis, uterus, bladder, spleen,
ovaries, lung, brain and muscle (at protein level). Expressed in
brain, testis, kidney, heart, liver and lung.
SIMILARITY: Belongs to the rad1 family.
Links to other databases:
Protein sequence:
MPLLTQYNEEEYEQYCLVASLDNVRNLSTVLKAIHFREHATCFATKNGIK
VTVENAKCVQANAFIQADVFQEFVIQEESVTFRINLTILLDCLSIFGSSP
TPGTLTALRMCYQGYGHPLMLFLEEGGVVTVCKITTQEPEETLDFDFCST
NVMNKIILQSEGLREAFSELDMTGDVLQITVSPDKPYFRLSTFGNAGNSH
LDYPKDSDLVEAFHCDKTQVNRYKLSLLKPSTKALALSCKVSIRTDNRGF
LSLQYMIRNEDGQICFVEYYCCPDEEVPES
|
Rad1 (Mus musculus) belongs to following protein families:
References:
|
Title
|
Authors
|
Journal
|
|
A human homologue of the Schizosaccharomyces pombe rad1+ checkpoint gene encodes an exonuclease.
|
Parker AE, Van de Weyer I, Laus MC, Oostveen I, Yon J, Verhasselt P, Luyten WH
|
J Biol Chem
July 17, 1998
|
|
Human and mouse homologs of Schizosaccharomyces pombe rad1(+) and Saccharomyces cerevisiae RAD17: linkage to checkpoint control and mammalian meiosis.
|
Freire R, Murguia JR, Tarsounas M, Lowndes NF, Moens PB, Jackson SP
|
Genes Dev
Aug. 15, 1998
|
|
HRAD1 and MRAD1 encode mammalian homologues of the fission yeast rad1(+) cell cycle checkpoint control gene.
|
Udell CM, Lee SK, Davey S
|
Nucleic Acids Res
Sept. 1, 1998
|
|
A human and mouse homolog of the Schizosaccharomyces pombe rad1+ cell cycle checkpoint control gene.
|
Bluyssen HA, van Os RI, Naus NC, Jaspers I, Hoeijmakers JH, de Klein A
|
Genomics
Dec. 1, 1998
|
|
cDNA cloning and gene mapping of human homologs for Schizosaccharomyces pombe rad17, rad1, and hus1 and cloning of homologs from mouse, Caenorhabditis elegans, and Drosophila melanogaster.
|
Dean FB, Lian L, O'Donnell M
|
Genomics
Dec. 15, 1998
|
|
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
|
Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J
|
Genome Res
Oct. 1, 2004
|
|
The transcriptional landscape of the mammalian genome.
|
Carninci P, Kasukawa T, Katayama S, Gough J, Frith MC, Maeda N, Oyama R, Ravasi T, Lenhard B, Wells C, Kodzius R, Shimokawa K, Bajic VB, Brenner SE, Batalov S, Forrest AR, Zavolan M, Davis MJ, Wilming LG, Aidinis V, Allen JE, Ambesi-Impiombato A, Apweiler R, Aturaliya RN, Bailey TL, Bansal M, Baxter L, Beisel KW, Bersano T, Bono H, Chalk AM, Chiu KP, Choudhary V, Christoffels A, Clutterbuck DR, Crowe ML, Dalla E, Dalrymple BP, de Bono B, Della Gatta G, di Bernardo D, Down T, Engstrom P, Fagiolini M, Faulkner G, Fletcher CF, Fukushima T, Furuno M, Futaki S, Gariboldi M, Georgii-Hemming P, Gingeras TR, Gojobori T, Green RE, Gustincich S, Harbers M, Hayashi Y, Hensch TK, Hirokawa N, Hill D, Huminiecki L, Iacono M, Ikeo K, Iwama A, Ishikawa T, Jakt M, Kanapin A, Katoh M, Kawasawa Y, Kelso J, Kitamura H, Kitano H, Kollias G, Krishnan SP, Kruger A, Kummerfeld SK, Kurochkin IV, Lareau LF, Lazarevic D, Lipovich L, Liu J, Liuni S, McWilliam S, Madan Babu M, Madera M, Marchionni L, Matsuda H, Matsuzawa S, Miki H, Mignone F, Miyake S, Morris K, Mottagui-Tabar S, Mulder N, Nakano N, Nakauchi H, Ng P, Nilsson R, Nishiguchi S, Nishikawa S, Nori F, Ohara O, Okazaki Y, Orlando V, Pang KC, Pavan WJ, Pavesi G, Pesole G, Petrovsky N, Piazza S, Reed J, Reid JF, Ring BZ, Ringwald M, Rost B, Ruan Y, Salzberg SL, Sandelin A, Schneider C, Schonbach C, Sekiguchi K, Semple CA, Seno S, Sessa L, Sheng Y, Shibata Y, Shimada H, Shimada K, Silva D, Sinclair B, Sperling S, Stupka E, Sugiura K, Sultana R, Takenaka Y, Taki K, Tammoja K, Tan SL, Tang S, Taylor MS, Tegner J, Teichmann SA, Ueda HR, van Nimwegen E, Verardo R, Wei CL, Yagi K, Yamanishi H, Zabarovsky E, Zhu S, Zimmer A, Hide W, Bult C, Grimmond SM, Teasdale RD, Liu ET, Brusic V, Quackenbush J, Wahlestedt C, Mattick JS, Hume DA, Kai C, Sasaki D, Tomaru Y, Fukuda S, Kanamori-Katayama M, Suzuki M, Aoki J, Arakawa T, Iida J, Imamura K, Itoh M, Kato T, Kawaji H, Kawagashira N, Kawashima T, Kojima M, Kondo S, Konno H, Nakano K, Ninomiya N, Nishio T, Okada M, Plessy C, Shibata K, Shiraki T, Suzuki S, Tagami M, Waki K, Watahiki A, Okamura-Oho Y, Suzuki H, Kawai J, Hayashizaki Y
|
Science
Sept. 2, 2005
|
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|