Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Pol3p |
Protein FULL name:
Catalytic subunit of DNA polymerase delta; required for chromosomal DNA replication during mitosis and meiosis, intragenic recombination, repair of double strand DNA breaks, and DNA replication during nucleotide excision repair (NER)
Protein SHORT name:
POL3, CDC2, HPR6, TEX1
Pol3p (Saccharomyces cerevisiae) is product of expression of POL3 gene.
Pol3p is involved in:
MMR in Saccharomyces cerevisiae
- DNA polymerase delta resynthesizes DNA (5' directed MMR) in Saccharomyces cerevisiae
- DNA polymerase 3 resynthesizes DNA (5' directed MMR, proximal site) in Saccharomyces cerevisiae
- DNA polymerase 3 resynthesizes DNA (3' directed MMR) in Saccharomyces cerevisiae
- Strand scission by APN1/APN2/Pol30/Rad27/Pol3/CDC9 complex in Saccharomyces cerevisiae
- Gap filling and strand displacement with Pol3 in Saccharomyces cerevisiae
- Removing overhang by complex with Pol3 in Saccharomyces cerevisiae
- Ligation of DNA strands by CDC9 after processing by Pol3 in Saccharomyces cerevisiae
FUNCTION: DNA polymerase delta (DNA polymerase III) participates in chromosomal DNA replication. It is required during synthesis of the leading and lagging DNA strands at the replication fork and binds at/or near replication origins and moves along DNA with the replication fork. It has 3'-5' proofreading exonuclease activity that correct errors arising during DNA replication. It is also involved in DNA synthesis during DNA repair. POL3 contains the polymerase active site and most likely the active site for the 3'- 5' exonuclease activity.
CATALYTIC ACTIVITY: Deoxynucleoside triphosphate + DNA(n) = diphosphate + DNA(n+1).
SUBUNIT: DNA polymerase delta is a heterotrimer of POL3, POL32 and HYS2.
INTERACTION: P46957:HYS2; NbExp=2; IntAct=EBI-6134, EBI-6080;
SUBCELLULAR LOCATION: Nucleus.
MISCELLANEOUS: In eukaryotes there are five DNA polymerases: alpha, beta, gamma, delta, and epsilon which are responsible for different reactions of DNA synthesis.
SIMILARITY: Belongs to the DNA polymerase type-B family.
| NCBI GenPept GI number(s): |
6320101 1199547 |
| Species: | Saccharomyces cerevisiae |
Links to other databases:
| Database | ID | Link |
| Uniprot | P15436 |
P15436 |
| PFAM: | - |
P15436 (Link - using uniprot id) |
| InterPro: | - |
P15436 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MSEKRSLPMVDVKIDDEDTPQLEKKIKRQSIDHGVGSEPVSTIEIIPSDS FRKYNSQGFKAKDTDLMGTQLESTFEQDVSQMEHDMADQEEHDLSSFERK KLPTDFDPSLYDISFQQIDAEQSVLNGIKDENTSTVVRFFGVTSEGHSVL CNVTGFKNYLYVPAPNSSDANDQEQINKFVHYLNETFDHAIDSIEVVSKQ SIWGYSGDTKLPFWKIYVTYPHMVNKLRTAFERGHLSFNSWFSNGTTTYD NIAYTLRLMVDCGIVGMSWITLPKGKYSMIEPNNRVSSCQLEVSINYRNL IAHPAEGDWSHTAPLRIMSFDIECAGRIGVFPEPEYDPVIQIANVVSIAG AKKPFIRNVFTLNTCSPITGSMIFSHATEEEMLSNWRNFIIKVDPDVIIG YNTTNFDIPYLLNRAKALKVNDFPYFGRLKTVKQEIKESVFSSKAYGTRE TKNVNIDGRLQLDLLQFIQREYKLRSYTLNAVSAHFLGEQKEDVHYSIIS DLQNGDSETRRRLAVYCLKDAYLPLRLMEKLMALVNYTEMARVTGVPFSY LLARGQQIKVVSQLFRKCLEIDTVIPNMQSQASDDQYEGATVIEPIRGYY DVPIATLDFNSLYPSIMMAHNLCYTTLCNKATVERLNLKIDEDYVITPNG DYFVTTKRRRGILPIILDELISARKRAKKDLRDEKDPFKRDVLNGRQLAL KISANSVYGFTGATVGKLPCLAISSSVTAYGRTMILKTKTAVQEKYCIKN GYKHDAVVVYGDTDSVMVKFGTTDLKEAMDLGTEAAKYVSTLFKHPINLE FEKAYFPYLLINKKRYAGLFWTNPDKFDKLDQKGLASVRRDSCSLVSIVM NKVLKKILIERNVDGALAFVRETINDILHNRVDISKLIISKTLAPNYTNP QPHAVLAERMKRREGVGPNVGDRVDYVIIGGNDKLYNRAEDPLFVLENNI QVDSRYYLTNQLQNPIISIVAPIIGDKQANGMFVVKSIKINTGSQKGGLM SFIKKVEACKSCKGPLRKGEGPLCSNCLARSGELYIKALYDVRDLEEKYS RLWTQCQRCAGNLHSEVLCSNKNCDIFYMRVKVKKELQEKVEQLSKW |
Pol3p (Saccharomyces cerevisiae) is able to recognize following damages:
Pol3p (Saccharomyces cerevisiae) belongs to following protein families:
References:
| Title | Authors | Journal |
| Structure and function of the Saccharomyces cerevisiae CDC2 gene encoding the large subunit of DNA polymerase III. | Boulet A, Simon M, Faye G, Bauer GA, Burgers PM | EMBO J June 1, 1989 |
| The 3' to 5' exonuclease activity located in the DNA polymerase delta subunit of Saccharomyces cerevisiae is required for accurate replication. | Simon M, Giot L, Faye G | EMBO J Aug. 1, 1991 |
| Nucleotide sequence of the POL3 gene encoding DNA polymerase III (delta) of Saccharomyces cerevisiae. | Morrison A, Sugino A | Nucleic Acids Res Feb. 25, 1992 |
| The sequence of a 20.3 kb DNA fragment from the left arm of Saccharomyces cerevisiae chromosome IV contains the KIN28, MSS2, PHO2, POL3 and DUN1 genes, and six new open reading frames. | Saiz JE, Buitrago MJ, Garcia R, Revuelta JL, Del Rey F | Yeast Sept. 1, 1996 |
| The nucleotide sequence of Saccharomyces cerevisiae chromosome IV. | Jacq C, Alt-Morbe J, Andre B, Arnold W, Bahr A, Ballesta JP, Bargues M, Baron L, Becker A, Biteau N, Blocker H, Blugeon C, Boskovic J, Brandt P, Bruckner M, Buitrago MJ, Coster F, Delaveau T, del Rey F, Dujon B, Eide LG, Garcia-Cantalejo JM, Goffeau A, Gomez-Peris A, Zaccaria P, et al. | Nature May 1, 1997 |
| Structure of DNA polymerase delta from Saccharomyces cerevisiae. | Johansson E, Majka J, Burgers PM | J Biol Chem Nov. 23, 2001 |
| Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry. | Chi A, Huttenhower C, Geer LY, Coon JJ, Syka JE, Bai DL, Shabanowitz J, Burke DJ, Troyanskaya OG, Hunt DF | Proc Natl Acad Sci U S A Jan. 13, 2007 |
| Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae. | Li X, Gerber SA, Rudner AD, Beausoleil SA, Haas W, Villen J, Elias JE, Gygi SP | J Proteome Res March 1, 2007 |
| Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases. | Smolka MB, Albuquerque CP, Chen SH, Zhou H | Proc Natl Acad Sci U S A June 19, 2007 |
| A multidimensional chromatography technology for in-depth phosphoproteome analysis. | Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H | Mol Cell Proteomics July 1, 2008 |
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|