Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Mus81 |
Protein FULL name:
crossover junction endonuclease MUS81 [Mus musculus].
Mus81 (Mus musculus) is product of expression of Mus81 gene.
FUNCTION: Interacts with EME1 and EME2 to form a DNA structure- specific endonuclease with substrate preference for branched DNA structures with a 5'-end at the branch nick. Typical substrates include 3'-flap structures, replication forks and nicked Holliday junctions. May be required in mitosis for the processing of stalled or collapsed replication forks.
COFACTOR: Magnesium.
SUBUNIT: May self-associate. Interacts with CHEK2. Interacts with BLM, and this interaction may stimulate the endonuclease activity of MUS81. Interacts with EME2. Interacts with BTBD12/SLX4; this interaction is direct and links the MUS81-EME1 complex to SLX4, which may coordinate the action of the structure-specific endonuclease during DNA repair (By similarity). Interacts with. EME1.
SUBCELLULAR LOCATION: Nucleus, nucleolus. Note=Recruited to foci of DNA damage in S-phase cells (By similarity).
SIMILARITY: Belongs to the XPF family.
SIMILARITY: Contains 1 ERCC4 domain.
| NCBI GenPept GI number(s): |
170016083 |
| Species: | Mus musculus |
Links to other databases:
| Database | ID | Link |
| Uniprot | Q91ZJ0 |
Q91ZJ0 |
| PFAM: | - |
Q91ZJ0 (Link - using uniprot id) |
| InterPro: | - |
Q91ZJ0 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MAEPVRLGRKRPLPVCPNPLFVRWLTEWRDEAASRGRHTRFVFQKALRSL QRYPLPLRSGKEAKILQHFGDRLCRMLDEKLKQHLASGGDHAPSSPSGKK GASKGPPEQVQDSSMPVPTQPQAGSTSVGYWPAQNSGAREILLQLYREHL NSDGHSFLTKEELLQKCAQKTPRVVPGSSKPWPALRSLLHRNLILGTHRP ARYALTPEGLELAQKLAEAEGLSTRHAGFRPEEHHGEDSAVPEALSEPGT TEGAVQQRPLELRPSEYRVLLCVDIGETRGAGHRPEMLRELQRLRVPHTV RKLHVGDFVWVAQETRPRDPERPGELVLDHIVERKRLDDLCSSIIDGRFR EQKFRLKRCGLGHRVYLVEEHGSVHNLSLPESTLLQAVTNTQVIDGFFVK RTMDIKESAGYLALLTKGLERLYQGHTLRSRPWGAPGAAESEAKPSTNPL CSLLTFSDFNAEAVKNKAQSVREVFARQLMQVRGLSGEKAAAVVDRYSTP ASLLAAYDACATAKEQEMLLSTIKCGRLQRNLGPALSRTLYQLYCSHSPL S |
Mus81 (Mus musculus) belongs to following protein families:
References:
| Title | Authors | Journal |
| Human Mus81-associated endonuclease cleaves Holliday junctions in vitro. | Chen XB, Melchionna R, Denis CM, Gaillard PH, Blasina A, Van de Weyer I, Boddy MN, Russell P, Vialard J, McGowan CH | Mol Cell Nov. 1, 2001 |
| Eme1 is involved in DNA damage processing and maintenance of genomic stability in mammalian cells. | Abraham J, Lemmers B, Hande MP, Moynahan ME, Chahwan C, Ciccia A, Essers J, Hanada K, Chahwan R, Khaw AK, McPherson P, Shehabeldin A, Laister R, Arrowsmith C, Kanaar R, West SC, Jasin M, Hakem R | EMBO J Nov. 17, 2003 |
| Involvement of mammalian Mus81 in genome integrity and tumor suppression. | McPherson JP, Lemmers B, Chahwan R, Pamidi A, Migon E, Matysiak-Zablocki E, Moynahan ME, Essers J, Hanada K, Poonepalli A, Sanchez-Sweatman O, Khokha R, Kanaar R, Jasin M, Hande MP, Hakem R | Science June 18, 2004 |
| The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J | Genome Res Oct. 1, 2004 |
| Disruption of murine Mus81 increases genomic instability and DNA damage sensitivity but does not promote tumorigenesis. | Dendouga N, Gao H, Moechars D, Janicot M, Vialard J, McGowan CH | Mol Cell Biol Sept. 1, 2005 |
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|