|
|
Protein FULL name: DNA repair protein RAD51 homolog 1 [Mus musculus].
Rad51 (Mus musculus) is product of expression of
Rad51
gene.
FUNCTION: May participate in a common DNA damage response pathway
associated with the activation of homologous recombination and
double-strand break repair. Binds to single and double stranded
DNA and exhibits DNA-dependent ATPase activity. Underwinds duplex
DNA and forms helical nucleoprotein filaments (By similarity).
SUBUNIT: Interacts with BRCA1, BRCA2 and either directly or
indirectly with p53. Interacts with XRCC3, RAD54L and RAD54B. Part
of a complex with RAD51C and RAD51B. Interacts with RAD51AP1 and
RAD51AP2. Interacts with CHEK1/CHK1, and this may require prior
phosphorylation of CHEK1 (By similarity). Interacts with the MND1-
PSMC3IP heterodimer. Interacts with OBFC2B (By similarity).
SUBCELLULAR LOCATION: Nucleus (By similarity). Note=Colocalizes
with RAD51AP1 to multiple nuclear foci upon induction of DNA
damage (By similarity).
TISSUE SPECIFICITY: Expressed in ovary and testis.
PTM: Phosphorylated. Phosphorylation of Thr-309 by CHEK1/CHK1 may
enhance association with chromatin at sites of DNA damage and
promote DNA repair by homologous recombination (By similarity).
MISCELLANEOUS: The nucleus of a mouse embryonic stem (ES) cells
contains on average 4.7 x 10(5) molecules.
SIMILARITY: Belongs to the recA family. RAD51 subfamily.
SIMILARITY: Contains 1 HhH domain.
Links to other databases:
Protein sequence:
MAMQMQLEASADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGYHTVE
AVAYAPKKELINIKGISEAKADKILTEAAKLVPMGFTTATEFHQRRSEII
QITTGSKELDKLLQGGIETGSITEMFGEFRTGKTQICHTLAVTCQLPIDR
GGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARGFNTDHQ
TQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLR
MLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRL
YLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD
|
Rad51 (Mus musculus) belongs to following protein families:
References:
|
Title
|
Authors
|
Journal
|
|
Cloning of human, mouse and fission yeast recombination genes homologous to RAD51 and recA.
|
Shinohara A, Ogawa H, Matsuda Y, Ushio N, Ikeo K, Ogawa T
|
Nat Genet
July 1, 1993
|
|
A mouse homolog of the Escherichia coli recA and Saccharomyces cerevisiae RAD51 genes.
|
Morita T, Yoshimura Y, Yamamoto A, Murata K, Mori M, Yamamoto H, Matsushiro A
|
Proc Natl Acad Sci U S A
July 15, 1993
|
|
Analysis of mouse Rad54 expression and its implications for homologous recombination.
|
Essers J, Hendriks RW, Wesoly J, Beerens CE, Smit B, Hoeijmakers JH, Wyman C, Dronkert ML, Kanaar R
|
DNA Repair (Amst)
Oct. 1, 2002
|
|
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
|
Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J
|
Genome Res
Oct. 1, 2004
|
|
The Hop2 and Mnd1 proteins act in concert with Rad51 and Dmc1 in meiotic recombination.
|
Petukhova GV, Pezza RJ, Vanevski F, Ploquin M, Masson JY, Camerini-Otero RD
|
Nat Struct Mol Biol
May 1, 2005
|
|
The transcriptional landscape of the mammalian genome.
|
Carninci P, Kasukawa T, Katayama S, Gough J, Frith MC, Maeda N, Oyama R, Ravasi T, Lenhard B, Wells C, Kodzius R, Shimokawa K, Bajic VB, Brenner SE, Batalov S, Forrest AR, Zavolan M, Davis MJ, Wilming LG, Aidinis V, Allen JE, Ambesi-Impiombato A, Apweiler R, Aturaliya RN, Bailey TL, Bansal M, Baxter L, Beisel KW, Bersano T, Bono H, Chalk AM, Chiu KP, Choudhary V, Christoffels A, Clutterbuck DR, Crowe ML, Dalla E, Dalrymple BP, de Bono B, Della Gatta G, di Bernardo D, Down T, Engstrom P, Fagiolini M, Faulkner G, Fletcher CF, Fukushima T, Furuno M, Futaki S, Gariboldi M, Georgii-Hemming P, Gingeras TR, Gojobori T, Green RE, Gustincich S, Harbers M, Hayashi Y, Hensch TK, Hirokawa N, Hill D, Huminiecki L, Iacono M, Ikeo K, Iwama A, Ishikawa T, Jakt M, Kanapin A, Katoh M, Kawasawa Y, Kelso J, Kitamura H, Kitano H, Kollias G, Krishnan SP, Kruger A, Kummerfeld SK, Kurochkin IV, Lareau LF, Lazarevic D, Lipovich L, Liu J, Liuni S, McWilliam S, Madan Babu M, Madera M, Marchionni L, Matsuda H, Matsuzawa S, Miki H, Mignone F, Miyake S, Morris K, Mottagui-Tabar S, Mulder N, Nakano N, Nakauchi H, Ng P, Nilsson R, Nishiguchi S, Nishikawa S, Nori F, Ohara O, Okazaki Y, Orlando V, Pang KC, Pavan WJ, Pavesi G, Pesole G, Petrovsky N, Piazza S, Reed J, Reid JF, Ring BZ, Ringwald M, Rost B, Ruan Y, Salzberg SL, Sandelin A, Schneider C, Schonbach C, Sekiguchi K, Semple CA, Seno S, Sessa L, Sheng Y, Shibata Y, Shimada H, Shimada K, Silva D, Sinclair B, Sperling S, Stupka E, Sugiura K, Sultana R, Takenaka Y, Taki K, Tammoja K, Tan SL, Tang S, Taylor MS, Tegner J, Teichmann SA, Ueda HR, van Nimwegen E, Verardo R, Wei CL, Yagi K, Yamanishi H, Zabarovsky E, Zhu S, Zimmer A, Hide W, Bult C, Grimmond SM, Teasdale RD, Liu ET, Brusic V, Quackenbush J, Wahlestedt C, Mattick JS, Hume DA, Kai C, Sasaki D, Tomaru Y, Fukuda S, Kanamori-Katayama M, Suzuki M, Aoki J, Arakawa T, Iida J, Imamura K, Itoh M, Kato T, Kawaji H, Kawagashira N, Kawashima T, Kojima M, Kondo S, Konno H, Nakano K, Ninomiya N, Nishio T, Okada M, Plessy C, Shibata K, Shiraki T, Suzuki S, Tagami M, Waki K, Watahiki A, Okamura-Oho Y, Suzuki H, Kawai J, Hayashizaki Y
|
Science
Sept. 2, 2005
|
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|