Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Pcna

Protein FULL name:

proliferating cell nuclear antigen [Mus musculus].


Pcna (Mus musculus) is product of expression of Pcna gene.






FUNCTION: This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand.

SUBUNIT: Homotrimer (By similarity). Forms a complex with activator 1 heteropentamer in the presence of ATP. Interacts with POLH, POLK, DNMT1, ERCC5, FEN1, CDC6, POLD1, POLD3, POLD4 and POLDIP2. Interacts with EXO1, KCTD10 and SHPRH. Forms a ternary complex with DNTTIP2 and core histone. Interacts with BAZ1B; the interaction is direct. Interacts with HLTF and SHPRH (By similarity). Interacts with APEX2 and PPP1R15A. Interacts with HHV-1 ICP34.5. Interacts with NUDT15 (By similarity). Interaction is disrupted in response to UV irradiation and acetylation (By similarity).

INTERACTION: Q9Z111:Gadd45g; NbExp=1; IntAct=EBI-1173716, EBI-1173616; P12004:PCNA (xeno); NbExp=1; IntAct=EBI-1173716, EBI-358311; P62137:Ppp1ca; NbExp=2; IntAct=EBI-1173716, EBI-357187; P63087-1:Ppp1cc; NbExp=1; IntAct=EBI-1173716, EBI-450267;

SUBCELLULAR LOCATION: Nucleus.

INDUCTION: Induced in IL2-stimulated proliferating T-lymphocytes.

PTM: Upon methyl methanesulfonate-induced DNA damage, mono- ubiquitinated by the UBE2B-RAD18 complex on Lys-164. This induces non-canonical poly-ubiquitination on Lys-164 through 'Lys-63' linkage of ubiquitin moieties by the E2 complex UBE2N-UBE2V2 and the E3 ligases, HLTF, RNF8 and SHPRH, which is required for DNA repair. 'Lys-63' polyubiquitination prevents genomic instability on DNA damage (By similarity).

PTM: Acetylated in response to UV irradiation. Acetylation disrupts interaction with NUDT15 and promotes degradation (By similarity).

SIMILARITY: Belongs to the PCNA family.


NCBI GenPept GI number(s): 7242171
Species: Mus musculus

Links to other databases:

Database ID Link
Uniprot P17918 P17918
PFAM: - P17918 (Link - using uniprot id)
InterPro: - P17918 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MFEARLIQGSILKKVLEALKDLINEACWDVSSGGVNLQSMDSSHVSLVQL
TLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLA
LVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVIKMPSGEFARICRD
LSHIGDAVVISCAKNGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMN
EPVHLTFALRYLNFFTKATPLSPTVTLSMSADVPLVVEYKIADMGHLKYY
LAPKIEDEEAS

Pcna (Mus musculus) is able to recognize following damages:
Pcna (Mus musculus) belongs to following protein families:
References:

Title Authors Journal
Cyclin mRNA and protein expression in recombinant interleukin 2-stimulated cloned murine T lymphocytes. Shipman PM, Sabath DE, Fischer AH, Comber PG, Sullivan K, Tan EM, Prystowsky MB J Cell Biochem Nov. 1, 1988
Nucleotide sequence of murine PCNA: interspecies comparison of the cDNA and the 5' flanking region of the gene. Shipman-Appasamy PM, Cohen KS, Prystowsky MB DNA Seq Jan. 1, 1991
Molecular cloning and structural analysis of mouse gene and pseudogenes for proliferating cell nuclear antigen. Yamaguchi M, Hayashi Y, Hirose F, Matsuoka S, Moriuchi T, Shiroishi T, Moriwaki K, Matsukage A Nucleic Acids Res May 11, 1991
The herpes simplex virus virulence factor ICP34.5 and the cellular protein MyD116 complex with proliferating cell nuclear antigen through the 63-amino-acid domain conserved in ICP34.5, MyD116, and GADD34. Brown SM, MacLean AR, McKie EA, Harland J J Virol Dec. 1, 1997
Characterization of the genomic structure and expression of the mouse Apex2 gene. Ide Y, Tsuchimoto D, Tominaga Y, Iwamoto Y, Nakabeppu Y Genomics Feb. 1, 2003
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J Genome Res Oct. 1, 2004


Last modification of this entry: Oct. 6, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.