|
|
Protein FULL name: xeroderma pigmentosum, complementation group A [Mus musculus].
Xpa (Mus musculus) is product of expression of
Xpa
gene.
FUNCTION: Involved in DNA excision repair. Initiates repair by
binding to damaged sites with various affinities, depending on the
photoproduct and the transcriptional state of the region. Required
for UV-induced CHK1 phosphorylation and the recruitment of CEP164
to cyclobutane pyrimidine dimmers (CPD), sites of DNA damage after
UV irradiation (By similarity).
SUBUNIT: Interacts with XAB1 and RPA1. Interacts (via N-terminus)
with CEP164 upon UV irradiation. Interacts with HERC2 (By
similarity).
SUBCELLULAR LOCATION: Nucleus.
INDUCTION: Exhibits a circadian pattern with zenith at around 5 pm
and nadir at around 5 am in liver but not in testis, this
oscillation is dependent on the circadian clock and on HERC2
regulation.
PTM: Phosphorylated upon DNA damage, probably by ATM or ATR (By
similarity).
PTM: Ubiquitinated by HERC2 leading to degradation by the
proteasome (By similarity).
DISRUPTION PHENOTYPE: Deficient mice cannot repair UV-induced DNA
damage and easily develop skin cancers by UV irradiation. They
develop stronger longer-lasting acute inflammation, they show a
more severe UV-induced damage of keratinocytes and Langerhans
cells as well as the enhancement of local and systemic
immunosuppression. PGE2 and COX2 expression is greatly increased
after UVB irradiation, this causes the enhancement of inflammation
and immunosuppression. Natural killer cell activity is also
significantly decreased.
MISCELLANEOUS: Plays an essential role in the repair of cisplatin
induced damage by nucleotide excision repair. Cisplatin is one of
the most commnly used anticancer drugs.
SIMILARITY: Belongs to the XPA family.
Links to other databases:
Protein sequence:
MATAEEKQTSPEPVAADEPAQLPAAVRASVERKRQRALMLRQARLAARPY
PAAAATGGVASVKAAPKMIDTKGGFILEEEEEKHEIGNIVHEPGPVMEFD
YTICEECGKEFMDSYLMNHFDLPTCDSCRDADDKHKLITKTEAKQEYLLK
DCDLEKREPALRFLVKKNPRHSQWGDMKLYLKLQVVKRALEVWGSQEALE
DAKEVRQENREKMKQKKFDKKVKELRRAIRSSVWKRETTTHQHEYGPEEN
LEDDMYRKTCTLCGHELTYEKM
|
Xpa (Mus musculus) is able to recognize following damages:
Xpa (Mus musculus) belongs to following protein families:
References:
|
Title
|
Authors
|
Journal
|
|
Cloning and characterization of the mouse XPAC gene.
|
van Oostrom CT, de Vries A, Verbeek SJ, van Kreijl CF, van Steeg H
|
Nucleic Acids Res
Feb. 11, 1994
|
|
Photobiologic and photoimmunologic characteristics of XPA gene-deficient mice.
|
Horio T, Miyauchi-Hashimoto H, Kuwamoto K, Horiki S, Okamoto H, Tanaka K
|
J Investig Dermatol Symp Proc
Nov. 1, 2001
|
|
Phosphoproteomic analysis of the developing mouse brain.
|
Ballif BA, Villen J, Beausoleil SA, Schwartz D, Gygi SP
|
Mol Cell Proteomics
Nov. 1, 2004
|
|
The transcriptional landscape of the mammalian genome.
|
Carninci P, Kasukawa T, Katayama S, Gough J, Frith MC, Maeda N, Oyama R, Ravasi T, Lenhard B, Wells C, Kodzius R, Shimokawa K, Bajic VB, Brenner SE, Batalov S, Forrest AR, Zavolan M, Davis MJ, Wilming LG, Aidinis V, Allen JE, Ambesi-Impiombato A, Apweiler R, Aturaliya RN, Bailey TL, Bansal M, Baxter L, Beisel KW, Bersano T, Bono H, Chalk AM, Chiu KP, Choudhary V, Christoffels A, Clutterbuck DR, Crowe ML, Dalla E, Dalrymple BP, de Bono B, Della Gatta G, di Bernardo D, Down T, Engstrom P, Fagiolini M, Faulkner G, Fletcher CF, Fukushima T, Furuno M, Futaki S, Gariboldi M, Georgii-Hemming P, Gingeras TR, Gojobori T, Green RE, Gustincich S, Harbers M, Hayashi Y, Hensch TK, Hirokawa N, Hill D, Huminiecki L, Iacono M, Ikeo K, Iwama A, Ishikawa T, Jakt M, Kanapin A, Katoh M, Kawasawa Y, Kelso J, Kitamura H, Kitano H, Kollias G, Krishnan SP, Kruger A, Kummerfeld SK, Kurochkin IV, Lareau LF, Lazarevic D, Lipovich L, Liu J, Liuni S, McWilliam S, Madan Babu M, Madera M, Marchionni L, Matsuda H, Matsuzawa S, Miki H, Mignone F, Miyake S, Morris K, Mottagui-Tabar S, Mulder N, Nakano N, Nakauchi H, Ng P, Nilsson R, Nishiguchi S, Nishikawa S, Nori F, Ohara O, Okazaki Y, Orlando V, Pang KC, Pavan WJ, Pavesi G, Pesole G, Petrovsky N, Piazza S, Reed J, Reid JF, Ring BZ, Ringwald M, Rost B, Ruan Y, Salzberg SL, Sandelin A, Schneider C, Schonbach C, Sekiguchi K, Semple CA, Seno S, Sessa L, Sheng Y, Shibata Y, Shimada H, Shimada K, Silva D, Sinclair B, Sperling S, Stupka E, Sugiura K, Sultana R, Takenaka Y, Taki K, Tammoja K, Tan SL, Tang S, Taylor MS, Tegner J, Teichmann SA, Ueda HR, van Nimwegen E, Verardo R, Wei CL, Yagi K, Yamanishi H, Zabarovsky E, Zhu S, Zimmer A, Hide W, Bult C, Grimmond SM, Teasdale RD, Liu ET, Brusic V, Quackenbush J, Wahlestedt C, Mattick JS, Hume DA, Kai C, Sasaki D, Tomaru Y, Fukuda S, Kanamori-Katayama M, Suzuki M, Aoki J, Arakawa T, Iida J, Imamura K, Itoh M, Kato T, Kawaji H, Kawagashira N, Kawashima T, Kojima M, Kondo S, Konno H, Nakano K, Ninomiya N, Nishio T, Okada M, Plessy C, Shibata K, Shiraki T, Suzuki S, Tagami M, Waki K, Watahiki A, Okamura-Oho Y, Suzuki H, Kawai J, Hayashizaki Y
|
Science
Sept. 2, 2005
|
|
Lineage-specific biology revealed by a finished genome assembly of the mouse.
|
Church DM, Goodstadt L, Hillier LW, Zody MC, Goldstein S, She X, Bult CJ, Agarwala R, Cherry JL, DiCuccio M, Hlavina W, Kapustin Y, Meric P, Maglott D, Birtle Z, Marques AC, Graves T, Zhou S, Teague B, Potamousis K, Churas C, Place M, Herschleb J, Runnheim R, Forrest D, Amos-Landgraf J, Schwartz DC, Cheng Z, Lindblad-Toh K, Eichler EE, Ponting CP
|
PLoS Biol
May 5, 2009
|
|
Circadian control of XPA and excision repair of cisplatin-DNA damage by cryptochrome and HERC2 ubiquitin ligase.
|
Kang TH, Lindsey-Boltz LA, Reardon JT, Sancar A
|
Proc Natl Acad Sci U S A
March 16, 2010
|
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|