Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Mutyh |
Protein FULL name:
mutY homolog [Mus musculus].
Mutyh (Mus musculus) is product of expression of Mutyh gene.
FUNCTION: Involved in oxidative DNA damage repair. Initiates repair of A*oxoG to C*G by removing the inappropriately paired adenine base from the DNA backbone. Possesses both adenine and 2- OH-A DNA glycosylase activities (By similarity).
COFACTOR: Binds 1 4Fe-4S cluster. The cluster is not important for the catalytic activity, but which is probably involved in the proper positioning of the enzyme along the DNA strand (By similarity).
SUBCELLULAR LOCATION: Nucleus (By similarity).
SIMILARITY: Belongs to the nth/mutY family.
SIMILARITY: Contains 1 nudix hydrolase domain.
| NCBI GenPept GI number(s): |
18875428 |
| Species: | Mus musculus |
Links to other databases:
| Database | ID | Link |
| Uniprot | Q99P21 |
Q99P21 |
| PFAM: | - |
Q99P21 (Link - using uniprot id) |
| InterPro: | - |
Q99P21 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MKKLQASVRSHKKQPANHKRRRTRALSSSQAKPSSLDGLAKQKREELLQA SVSPYHLFSDVADVTAFRSNLLSWYDQEKRDLPWRNLAKEEANSDRRAYA VWVSEVMLQQTQVATVIDYYTRWMQKWPKLQDLASASLEEVNQLWSGLGY YSRGRRLQEGARKVVEELGGHMPRTAETLQQLLPGVGRYTAGAIASIAFD QVTGVVDGNVLRVLCRVRAIGADPTSTLVSHHLWNLAQQLVDPARPGDFN QAAMELGATVCTPQRPLCSHCPVQSLCRAYQRVERGQLSALPGRPDIEEC ALNTRQCQLCLPPSSPWDPSMGVANFPRKASRRPPREEYSATCVVEQPGA IGGPLVLLVQRPDSGLLAGLWEFPSVTLEPSEQHQHKALLQELQRWCGPL PAIRLQHLGEVIHIFSHIKLTYQVYSLALDQAPASTAPPGARWLTWEEFC NAAVSTAMKKVFRMYEDHRQGTRKGSKRSQVCPPSSRKKPSLGQQVLDTF FQRHIPTDKPNSTTQ |
Mutyh (Mus musculus) belongs to following protein families:
References:
| Title | Authors | Journal |
| Enhanced activity of adenine-DNA glycosylase (Myh) by apurinic/apyrimidinic endonuclease (Ape1) in mammalian base excision repair of an A/GO mismatch. | Yang H, Clendenin WM, Wong D, Demple B, Slupska MM, Chiang JH, Miller JH | Nucleic Acids Res Jan. 1, 2001 |
| Identification and characterization of two forms of mouse MUTYH proteins encoded by alternatively spliced transcripts. | Ichinoe A, Behmanesh M, Tominaga Y, Ushijima Y, Hirano S, Sakai Y, Tsuchimoto D, Sakumi K, Wake N, Nakabeppu Y | Nucleic Acids Res Jan. 1, 2004 |
| The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J | Genome Res Oct. 1, 2004 |
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|