Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Ung

Protein FULL name:

uracil-DNA glycosylase isoform a [Mus musculus].


Ung (Mus musculus) is product of expression of Ung gene.






FUNCTION: Excises uracil residues from the DNA which can arise as a result of misincorporation of dUMP residues by DNA polymerase or due to deamination of cytosine.

CATALYTIC ACTIVITY: Hydrolyzes single-stranded DNA or mismatched double-stranded DNA and polynucleotides, releasing free uracil.

SUBUNIT: Monomer (By similarity).

SUBCELLULAR LOCATION: Isoform 1: Mitochondrion.

SUBCELLULAR LOCATION: Isoform 2: Nucleus.

PTM: Isoform 1 is processed by cleavage of a transit peptide.

SIMILARITY: Belongs to the uracil-DNA glycosylase family.


NCBI GenPept GI number(s): 101943608
Species: Mus musculus

Links to other databases:

Database ID Link
Uniprot P97931 P97931
PFAM: - P97931 (Link - using uniprot id)
InterPro: - P97931 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MIGQKTLYSFFSPTPTGKRTTRSPEPVPGSGVAAEIGGDAVASPAKKARV
EQNEQGSPLSAEQLVRIQRNKAAALLRLAARNVPAGFGESWKQQLCGEFG
KPYFVKLMGFVAEERNHHKVYPPPEQVFTWTQMCDIRDVKVVILGQDPYH
GPNQAHGLCFSVQRPVPPPPSLENIFKELSTDIDGFVHPGHGDLSGWARQ
GVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNLSGLVFLLWGSY
AQKKGSVIDRKRHHVLQTAHPSPLSVHRGFLGCRHFSKANELLQKSGKKP
INWKEL

Ung (Mus musculus) is able to recognize following damages:
Ung (Mus musculus) belongs to following protein families:
References:

Title Authors Journal
Nuclear and mitochondrial uracil-DNA glycosylases are generated by alternative splicing and transcription from different positions in the UNG gene. Nilsen H, Otterlei M, Haug T, Solum K, Nagelhus TA, Skorpen F, Krokan HE Nucleic Acids Res Jan. 15, 1997
The mouse uracil-DNA glycosylase gene: isolation of cDNA and genomic clones and mapping ung to mouse chromosome 5. Svendsen PC, Yee HA, Winkfein RJ, van de Sande JH Gene April 21, 1997
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J Genome Res Oct. 1, 2004


Last modification of this entry: Oct. 6, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.