REPAIRtoire - a database of DNA repair pathways

Welcome! Click here to login or here to register.

Home

Bujnicki Lab Homepage

Ogg1

Protein FULL name:

N-glycosylase/DNA lyase [Mus musculus].

Ogg1 (Mus musculus) is product of expression of Ogg1 gene.

FUNCTION: DNA repair enzyme that incises DNA at 8-oxoG residues. Excises 7,8-dihydro-8-oxoguanine and 2,6-diamino-4-hydroxy-5-N- methylformamidopyrimidine (FAPY) from damaged DNA. Has a beta- lyase activity that nicks DNA 3' to the lesion.

CATALYTIC ACTIVITY: The C-O-P bond 3' to the apurinic or apyrimidinic site in DNA is broken by a beta-elimination reaction, leaving a 3'-terminal unsaturated sugar and a product with a terminal 5'-phosphate.

SUBCELLULAR LOCATION: Nucleus (By similarity).

TISSUE SPECIFICITY: Highest expression in testis.

SIMILARITY: Belongs to the type-1 OGG1 family.

NCBI GenPept GI number(s):	187960092
Species:	Mus musculus

Links to other databases:

Database	ID	Link
Uniprot	O08760	O08760
PFAM:	-	O08760 (Link - using uniprot id)
InterPro:	-	O08760 (Link - using uniprot id)
CATH:	-	-
SCOP:	-	-
PDB:	-	-

Protein sequence:

MLFRSWLPSSMRHRTLSSSPALWASIPCPRSELRLDLVLASGQSFRWKEQ
SPAHWSGVLADQVWTLTQTEDQLYCTVYRGDDSQVSRPTLEELETLHKYF
QLDVSLAQLYSHWASVDSHFQRVAQKFQGVRLLRQDPTECLFSFICSSNN
NIARITGMVERLCQAFGPRLIQLDDVTYHGFPNLHALAGPEAETHLRKLG
LGYRARYVRASAKAILEEQGGPAWLQQLRVAPYEEAHKALCTLPGVGAKV
ADCICLMALDKPQAVPVDVHVWQIAHRDYGWHPKTSQAKGPSPLANKELG
NFFRNLWGPYAGWAQAVLFSADLRQPSLSREPPAKRKKGSKRPEG

Ogg1 (Mus musculus) is able to recognize following damages:

8-oxoG
FapyA

Ogg1 (Mus musculus) belongs to following protein families:

fam50v00000003147

References:

Title	Authors	Journal
Cloning and characterization of mammalian 8-hydroxyguanine-specific DNA glycosylase/apurinic, apyrimidinic lyase, a functional mutM homologue.	Aburatani H, Hippo Y, Ishida T, Takashima R, Matsuba C, Kodama T, Takao M, Yasui A, Yamamoto K, Asano M	Cancer Res June 1, 1997
A mammalian DNA repair enzyme that excises oxidatively damaged guanines maps to a locus frequently lost in lung cancer.	Lu R, Nash HM, Verdine GL	Curr Biol June 1, 1997
Cloning and characterization of a mammalian 8-oxoguanine DNA glycosylase.	Rosenquist TA, Zharkov DO, Grollman AP	Proc Natl Acad Sci U S A July 8, 1997
Opposite base-dependent reactions of a human base excision repair enzyme on DNA containing 7,8-dihydro-8-oxoguanine and abasic sites.	Bjoras M, Luna L, Johnsen B, Hoff E, Haug T, Rognes T, Seeberg E	EMBO J Oct. 15, 1997
Genomic structure and chromosomal localization of the mouse Ogg1 gene that is involved in the repair of 8-hydroxyguanine in DNA damage.	Tani M, Shinmura K, Kohno T, Shiroishi T, Wakana S, Kim SR, Nohmi T, Kasai H, Takenoshita S, Nagamachi Y, Yokota J	Mamm Genome Feb. 1, 1998

Last modification of this entry: Oct. 6, 2010.

Add your own comment!

There is no comment yet.

Welcome stranger! Click here to login or here to register.