|
|
Protein FULL name: methyl-CpG-binding domain protein 4 [Mus musculus].
Mbd4 (Mus musculus) is product of expression of
Mbd4
gene.
FUNCTION: Mismatch-specific DNA N-glycosylase involved in DNA
repair. Has thymine glycosylase activity and is specific for G:T
mismatches within methylated and unmethylated CpG sites. Can also
remove uracil or 5-fluorouracil in G:U mismatches. Has no lyase
activity. Was first identified as methyl-CpG-binding protein.
SUBUNIT: Interacts with MLH1 (By similarity).
SUBCELLULAR LOCATION: Nucleus. Note=Nuclear, in discrete foci.
SIMILARITY: Contains 1 MBD (methyl-CpG-binding) domain.
Links to other databases:
Protein sequence:
MESPNLGDNRVRGESLVPDPPWDRCKEDIAVGLGGVGEDGKDLVISSERS
SLLQEPTASTLSSTTATEGHKPVPCGWERVVKQRLSGKTAGKFDVYFISP
QGLKFRSKRSLANYLLKNGETFLKPEDFDFTVLPKGSINPGYKHQSLAAL
TSLQPNETDVSKQNLKTRSKWKTDVLPLPSGTSESPESSGLSNSNSACLL
LREHRDIQDVDSEKRRKSKRKVTVLKGTASQKTKQKCRKSLLESTQRNRK
RASVVQKVGADRELVPQESQLNRTLCPADACARETVGLAGEEKSPSPGLD
LCFIQVTSGTTNKFHSTEAAGEANREQTFLESEEIRSKGDRKGEAHLHTG
VLQDGSEMPSCSQAKKHFTSETFQEDSIPRTQVEKRKTSLYFSSKYNKEA
LSPPRRKSFKKWTPPRSPFNLVQEILFHDPWKLLIATIFLNRTSGKMAIP
VLWEFLEKYPSAEVARAADWRDVSELLKPLGLYDLRAKTIIKFSDEYLTK
QWRYPIELHGIGKYGNDSYRIFCVNEWKQVHPEDHKLNKYHDWLWENHEK
LSLS
|
Mbd4 (Mus musculus) belongs to following protein families:
References:
|
Title
|
Authors
|
Journal
|
|
Identification and characterization of a family of mammalian methyl-CpG binding proteins.
|
Hendrich B, Bird A
|
Mol Cell Biol
Nov. 1, 1998
|
|
Genomic structure and chromosomal mapping of the murine and human Mbd1, Mbd2, Mbd3, and Mbd4 genes.
|
Hendrich B, Abbott C, McQueen H, Chambers D, Cross S, Bird A
|
Mamm Genome
Sept. 1, 1999
|
|
Mismatch repair in methylated DNA. Structure and activity of the mismatch-specific thymine glycosylase domain of methyl-CpG-binding protein MBD4.
|
Wu P, Qiu C, Sohail A, Zhang X, Bhagwat AS, Cheng X
|
J Biol Chem
Jan. 14, 2003
|
|
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
|
Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J
|
Genome Res
Oct. 1, 2004
|
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|