|
|
Protein FULL name: centrin-2 [Mus musculus].
Cetn2 (Mus musculus) is product of expression of
Cetn2
gene.
FUNCTION: Plays a fundamental role in microtubule-organizing
center structure and function. Required for centriole duplication
and correct spindle formation. Has a role in regulating
cytokinesis and genome stability via cooperation with CALM1 and
CEP110 (By similarity).
SUBUNIT: Monomer. Interacts with CEP110, SFI1 and XPC (By
similarity).
SUBCELLULAR LOCATION: Cytoplasm, cytoskeleton, centrosome,
centriole. Note=Centrosome of S-phase, interphase and mitotic
cells.
TISSUE SPECIFICITY: Ubiquitously expressed in all adult tissues
tested, with strongest expression in brain, spleen, kidney, small
intestine and ovary. Also expressed in the NIH 3T3 fibroblast cell
line and peripheral blood lymphocytes.
MISCELLANEOUS: Binds two moles of calcium per mole of protein (By
similarity).
SIMILARITY: Belongs to the centrin family.
SIMILARITY: Contains 4 EF-hand domains.
SEQUENCE CAUTION:
Sequence=CAM20357.1; Type=Erroneous gene model prediction;
Links to other databases:
Protein sequence:
MASNFKKTTMASSAQRKRMSPKPELTEDQKQEIREAFDLFDADGTGTIDI
KELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFSDFLTVMTQKMSEK
DTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEAD
RDGDGEVNEQEFLRIMKKTSLY
|
Cetn2 (Mus musculus) belongs to following protein families:
References:
|
Title
|
Authors
|
Journal
|
|
Comparative genome sequence analysis of the Bpa/Str region in mouse and Man.
|
Mallon AM, Platzer M, Bate R, Gloeckner G, Botcherby MR, Nordsiek G, Strivens MA, Kioschis P, Dangel A, Cunningham D, Straw RN, Weston P, Gilbert M, Fernando S, Goodall K, Hunter G, Greystrong JS, Clarke D, Kimberley C, Goerdes M, Blechschmidt K, Rump A, Hinzmann B, Mundy CR, Miller W, Poustka A, Herman GE, Rhodes M, Denny P, Rosenthal A, Brown SD
|
Genome Res
June 1, 2000
|
|
Characterization of the X-linked murine centrin Cetn2 gene.
|
Hart PE, Poynter GM, Whitehead CM, Orth JD, Glantz JN, Busby RC, Barrett SL, Salisbury JL
|
Gene
Jan. 21, 2001
|
|
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
|
Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J
|
Genome Res
Oct. 1, 2004
|
|
The transcriptional landscape of the mammalian genome.
|
Carninci P, Kasukawa T, Katayama S, Gough J, Frith MC, Maeda N, Oyama R, Ravasi T, Lenhard B, Wells C, Kodzius R, Shimokawa K, Bajic VB, Brenner SE, Batalov S, Forrest AR, Zavolan M, Davis MJ, Wilming LG, Aidinis V, Allen JE, Ambesi-Impiombato A, Apweiler R, Aturaliya RN, Bailey TL, Bansal M, Baxter L, Beisel KW, Bersano T, Bono H, Chalk AM, Chiu KP, Choudhary V, Christoffels A, Clutterbuck DR, Crowe ML, Dalla E, Dalrymple BP, de Bono B, Della Gatta G, di Bernardo D, Down T, Engstrom P, Fagiolini M, Faulkner G, Fletcher CF, Fukushima T, Furuno M, Futaki S, Gariboldi M, Georgii-Hemming P, Gingeras TR, Gojobori T, Green RE, Gustincich S, Harbers M, Hayashi Y, Hensch TK, Hirokawa N, Hill D, Huminiecki L, Iacono M, Ikeo K, Iwama A, Ishikawa T, Jakt M, Kanapin A, Katoh M, Kawasawa Y, Kelso J, Kitamura H, Kitano H, Kollias G, Krishnan SP, Kruger A, Kummerfeld SK, Kurochkin IV, Lareau LF, Lazarevic D, Lipovich L, Liu J, Liuni S, McWilliam S, Madan Babu M, Madera M, Marchionni L, Matsuda H, Matsuzawa S, Miki H, Mignone F, Miyake S, Morris K, Mottagui-Tabar S, Mulder N, Nakano N, Nakauchi H, Ng P, Nilsson R, Nishiguchi S, Nishikawa S, Nori F, Ohara O, Okazaki Y, Orlando V, Pang KC, Pavan WJ, Pavesi G, Pesole G, Petrovsky N, Piazza S, Reed J, Reid JF, Ring BZ, Ringwald M, Rost B, Ruan Y, Salzberg SL, Sandelin A, Schneider C, Schonbach C, Sekiguchi K, Semple CA, Seno S, Sessa L, Sheng Y, Shibata Y, Shimada H, Shimada K, Silva D, Sinclair B, Sperling S, Stupka E, Sugiura K, Sultana R, Takenaka Y, Taki K, Tammoja K, Tan SL, Tang S, Taylor MS, Tegner J, Teichmann SA, Ueda HR, van Nimwegen E, Verardo R, Wei CL, Yagi K, Yamanishi H, Zabarovsky E, Zhu S, Zimmer A, Hide W, Bult C, Grimmond SM, Teasdale RD, Liu ET, Brusic V, Quackenbush J, Wahlestedt C, Mattick JS, Hume DA, Kai C, Sasaki D, Tomaru Y, Fukuda S, Kanamori-Katayama M, Suzuki M, Aoki J, Arakawa T, Iida J, Imamura K, Itoh M, Kato T, Kawaji H, Kawagashira N, Kawashima T, Kojima M, Kondo S, Konno H, Nakano K, Ninomiya N, Nishio T, Okada M, Plessy C, Shibata K, Shiraki T, Suzuki S, Tagami M, Waki K, Watahiki A, Okamura-Oho Y, Suzuki H, Kawai J, Hayashizaki Y
|
Science
Sept. 2, 2005
|
|
Solid tumor proteome and phosphoproteome analysis by high resolution mass spectrometry.
|
Zanivan S, Gnad F, Wickstrom SA, Geiger T, Macek B, Cox J, Fassler R, Mann M
|
J Proteome Res
Dec. 1, 2008
|
|
The phagosomal proteome in interferon-gamma-activated macrophages.
|
Trost M, English L, Lemieux S, Courcelles M, Desjardins M, Thibault P
|
Immunity
Feb. 16, 2009
|
|
Lineage-specific biology revealed by a finished genome assembly of the mouse.
|
Church DM, Goodstadt L, Hillier LW, Zody MC, Goldstein S, She X, Bult CJ, Agarwala R, Cherry JL, DiCuccio M, Hlavina W, Kapustin Y, Meric P, Maglott D, Birtle Z, Marques AC, Graves T, Zhou S, Teague B, Potamousis K, Churas C, Place M, Herschleb J, Runnheim R, Forrest D, Amos-Landgraf J, Schwartz DC, Cheng Z, Lindblad-Toh K, Eichler EE, Ponting CP
|
PLoS Biol
May 5, 2009
|
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|