Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Neil2 |
Protein FULL name:
endonuclease VIII-like 2 [Mus musculus].
Neil2 (Mus musculus) is product of expression of Neil2 gene.
FUNCTION: Involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. Has DNA glycosylase activity towards 5-hydroxyuracil and other oxidized derivatives of cytosine with a preference for mismatched double stranded DNA (DNA bubbles). Has low or no DNA glycosylase activity towards thymine glycol, 2-hydroxyadenine, hypoxanthine and 8-oxoguanine. Has AP (apurinic/apyrimidinic) lyase activity and introduces nicks in the DNA strand. Cleaves the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates (By similarity).
CATALYTIC ACTIVITY: Removes damaged bases from DNA, leaving an abasic site.
CATALYTIC ACTIVITY: The C-O-P bond 3' to the apurinic or apyrimidinic site in DNA is broken by a beta-elimination reaction, leaving a 3'-terminal unsaturated sugar and a product with a terminal 5'-phosphate.
ENZYME REGULATION: Acetylation of Lys-50 leads to loss of DNA nicking activity (By similarity).
SUBUNIT: Binds EP300 (By similarity).
SUBCELLULAR LOCATION: Nucleus (By similarity).
DOMAIN: The zinc-finger domain is important for DNA binding.
SIMILARITY: Belongs to the FPG family.
SIMILARITY: Contains 1 FPG-type zinc finger.
| NCBI GenPept GI number(s): |
118130803 |
| Species: | Mus musculus |
Links to other databases:
| Database | ID | Link |
| Uniprot | Q6R2P8 |
Q6R2P8 |
| PFAM: | - |
Q6R2P8 (Link - using uniprot id) |
| InterPro: | - |
Q6R2P8 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MPEGPSVRKFHHLVSPFVGQKVVKTGGSSKKLHPAAFQSLWLQDAQVHGK KLFLRFDPDEEMEPLNSSPQPIQGMWQKEAVDRELALGPSAQEPSAGPSG SGEPVPSRSAETYNLGKIPSADAQRWLEVRFGLFGSIWVNDFSRAKKANK KGDWRDPVPRLVLHFSGGGFLVFYNCQMSWSPPPVIEPTCDILSEKFHRG QALEALSQAQPVCYTLLDQRYFSGLGNIIKNEALYRARIHPLSLGSCLSS SSREALVDHVVEFSKDWLRDKFQGKERHTQIYQKEQCPSGHQVMKETFGP PDGLQRLTWWCPQCQPQLSSKGPQNLPSS |
Neil2 (Mus musculus) belongs to following protein families:
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|