Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Poli

Protein FULL name:

polymerase (DNA directed), iota isoform 2 [Mus musculus].


Poli (Mus musculus) is product of expression of Poli gene.






FUNCTION: Error-prone DNA polymerase specifically involved in DNA repair. Plays an important role in translesion synthesis, where the normal high-fidelity DNA polymerases cannot proceed and DNA synthesis stalls. Favors Hoogsteen base-pairing in the active site. Inserts the correct base with high-fidelity opposite an adenosine template. Exhibits low fidelity and efficiency opposite a thymidine template, where it will preferentially insert guanosine. May play a role in hypermutation of immunogobulin genes. Forms a Schiff base with 5'-deoxyribose phosphate at abasic sites, but may not have lyase activity (By similarity).

CATALYTIC ACTIVITY: Deoxynucleoside triphosphate + DNA(n) = diphosphate + DNA(n+1).

COFACTOR: Magnesium (By similarity).

SUBUNIT: Binds POLH (By similarity). Binds REV1L.

SUBCELLULAR LOCATION: Nucleus (By similarity). Note=Accumulates at replication forks after DNA damage (By similarity).

TISSUE SPECIFICITY: Detected in testis, and at very low levels in spleen, lung and brain. Detected in round spermatids, but not in prophase spermatocytes.

DOMAIN: The catalytic core consists of fingers, palm and thumb subdomains, but the fingers and thumb subdomains are much smaller than in high-fidelity polymerases; residues from five sequence motifs of the Y-family cluster around an active site cleft that can accommodate DNA and nucleotide substrates with relaxed geometric constraints, with consequently higher rates of misincorporation and low processivity (By similarity).

SIMILARITY: Belongs to the DNA polymerase type-Y family.

SIMILARITY: Contains 1 umuC domain.


NCBI GenPept GI number(s): 6755274
Species: Mus musculus

Links to other databases:

Database ID Link
Uniprot Q6R3M4 Q6R3M4
PFAM: - Q6R3M4 (Link - using uniprot id)
InterPro: - Q6R3M4 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MEPSHARAAGSSRAVCSQGPPTQISSSRVIVHVDLDCFYAQVEMISNPEL
KDRPLGVQQKYLVVTCNYEARKLGVRKLMNVRDAKEKCPQLVLVNGEDLS
RYREMSYKVTELLEEFSPAVERLGFDENFVDLTEMVEKRLQQLPSEEVPS
VTVFGHVYNNQSVNLHNIMHRRLVVGSQIAAEMREAMYNQLGLTGCAGVA
PNKLLAKLVSGVFKPNQQTVLLPESCQHLIHSLNHIKEIPGIGYKTAKRL
EVLGINSVHDLQTFPIKTLEKELGIAIAQRIQQLSFGEDKSPVTPSGPPQ
SFSEEDTFKKCSSEVEAKAKIEELLSSLLTRVCQDGRKPHTVRLVIRRYS
DKHCNRESRQCPIPSHVIQKLGTGNHDSMPPLIDILMKLFRNMVNVKMPF
HLTLMSVCFCNLKALSSAKKGPMDCYLTSLSTPAYTDKRAFKVKDTHTED
SHKEKEANWDCLPSRRIESTGTGESPLDATCFPKEKDTSDLPLQALPEGV
DQEVFKQLPADIQEEILSGKSRENLKGKGSLSCPLHASRGVLSFFSTKQM
QASRLSPRDTALPSKRVSAASPCEPGTSGLSPRSTSHPSCGKDCSYYIDS
QLKDEQTSQGPTESQGCQFSSTNPAVSGFHSFPNLQTEQLFSTHRTVDSH
KQTATASHQGLESHQGLESRELDSAEEKLPFPPDIDPQVFYELPEEVQKE
LMAEWERAGAARPSAHR

Poli (Mus musculus) is able to recognize following damages:
Poli (Mus musculus) belongs to following protein families:
References:

Title Authors Journal
Novel human and mouse homologs of Saccharomyces cerevisiae DNA polymerase eta. McDonald JP, Rapic-Otrin V, Epstein JA, Broughton BC, Wang X, Lehmann AR, Wolgemuth DJ, Woodgate R Genomics Aug. 15, 1999
Mouse Rev1 protein interacts with multiple DNA polymerases involved in translesion DNA synthesis. Guo C, Fischhaber PL, Luk-Paszyc MJ, Masuda Y, Zhou J, Kamiya K, Kisker C, Friedberg EC EMBO J Dec. 15, 2003
Pol iota is a candidate for the mouse pulmonary adenoma resistance 2 locus, a major modifier of chemically induced lung neoplasia. Wang M, Devereux TR, Vikis HG, McCulloch SD, Holliday W, Anna C, Wang Y, Bebenek K, Kunkel TA, Guan K, You M Cancer Res March 15, 2004
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J Genome Res Oct. 1, 2004


Last modification of this entry: Oct. 6, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.