Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Neil3

Protein FULL name:

endonuclease VIII-like 3 [Mus musculus].


Neil3 (Mus musculus) is product of expression of Neil3 gene.






FUNCTION: Reports about DNA glycosylase activity are contradictory. A number of references report finding no DNA glycosylase activity and the protein lacks a proline residue at the N-terminus which functions as an active site residue in other members of the FPG family. However, PubMed:20185759 has demonstrated that the protein has both DNA glycosylase and AP lyase activities and the human ortholog has been shown to possess AP lyase activity. Prefers single-stranded DNA or partially single-stranded DNA structures such as bubble and fork structures to double-stranded DNA in vitro. Displays a broad recognition spectrum, preferring FapyA and FapyG followed by 5-OHU, 5-PHC and 5-OHMH and then Tg and 8-oxoA. No activity on 8-oxoG detected.

CATALYTIC ACTIVITY: Removes damaged bases from DNA, leaving an abasic site.

CATALYTIC ACTIVITY: The C-O-P bond 3' to the apurinic or apyrimidinic site in DNA is broken by a beta-elimination reaction, leaving a 3'-terminal unsaturated sugar and a product with a terminal 5'-phosphate.

SUBCELLULAR LOCATION: Nucleus.

TISSUE SPECIFICITY: Expressed in testis, thymus, spleen and bone marrow. In young mice, expressed at higher levels in thymocytes than splenocytes. At E12, abundant in the subventricular zone (SVZ) of the lateral ventricles. At E17.5 and P0, expression is limited to distinct cells in the cortical SVZ, in cells of the secondary matrix, the dentate gyrus migratory route and the dentate gyrus.

DEVELOPMENTAL STAGE: Highly expressed in the developing brain at E12-E13 when neurogenesis starts. Expression decreases during later development and is undetectable in adult brain.

INDUCTION: By mitogen stimulation in splenocytes.

DISRUPTION PHENOTYPE: No effect on viability or fertility.

SIMILARITY: Belongs to the FPG family.

SIMILARITY: Contains 1 FPG-type zinc finger.

SIMILARITY: Contains 1 RanBP2-type zinc finger.


NCBI GenPept GI number(s): 22122759
Species: Mus musculus

Links to other databases:

Database ID Link
Uniprot Q8K203 Q8K203
PFAM: - Q8K203 (Link - using uniprot id)
InterPro: - Q8K203 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MVEGPGCTLNGEKIRARVLPGQAVTGVRGTALQSLLGPAMSPAASLADVA
TSAAPMNAKDSGWKLLRLFNGYVYSGVETLGKELFMYFGPRALRIHFGMK
GSILINPREGENRAGASPALAVQLTRDLICFYDSSVELRNSVESQQRVRV
MEELDICSPKFSFSRAESEVKKQGDRMLCDVLLDQRVLPGVGNIIKNEAL
FDSGLHPAVKVCQLSDKQACHLVKMTRDFSILFYRCCKAGSAISKHCKVY
KRPNCDQCHSKITVCRFGENSRMTYFCPHCQKENPQCVQVCQLPTRNTEI
SWTPRGEDCFTDSVARKSEEQWSCVVCTLINRPSAKACDACLTTRPLDSV
LKNRENSIAFNNLVKYPCNNFENTHTEVKINRKTAFGNTTLVLTDLSNKS
SALARKKRANHTIDGESQMFLPTDIGFSDSQHPSKEGINYITQPSNKVNI
SPTVCAQSKLFSSAHKKFKPAHTSATELKSYNSGLSNSELQTNRTRGHHS
KSDGSPLCKMHHRRCVLRVVRKDGENKGRQFYACSLPRGAQCGFFEWADL
SFPFCRHGKRSIMKTVLKIGPNNGKNFFVCPLEKKKQCNFFQWAENGPGM
EIVPGC

Neil3 (Mus musculus) belongs to following protein families:
References:

Title Authors Journal
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J Genome Res Oct. 1, 2004
The transcriptional landscape of the mammalian genome. Carninci P, Kasukawa T, Katayama S, Gough J, Frith MC, Maeda N, Oyama R, Ravasi T, Lenhard B, Wells C, Kodzius R, Shimokawa K, Bajic VB, Brenner SE, Batalov S, Forrest AR, Zavolan M, Davis MJ, Wilming LG, Aidinis V, Allen JE, Ambesi-Impiombato A, Apweiler R, Aturaliya RN, Bailey TL, Bansal M, Baxter L, Beisel KW, Bersano T, Bono H, Chalk AM, Chiu KP, Choudhary V, Christoffels A, Clutterbuck DR, Crowe ML, Dalla E, Dalrymple BP, de Bono B, Della Gatta G, di Bernardo D, Down T, Engstrom P, Fagiolini M, Faulkner G, Fletcher CF, Fukushima T, Furuno M, Futaki S, Gariboldi M, Georgii-Hemming P, Gingeras TR, Gojobori T, Green RE, Gustincich S, Harbers M, Hayashi Y, Hensch TK, Hirokawa N, Hill D, Huminiecki L, Iacono M, Ikeo K, Iwama A, Ishikawa T, Jakt M, Kanapin A, Katoh M, Kawasawa Y, Kelso J, Kitamura H, Kitano H, Kollias G, Krishnan SP, Kruger A, Kummerfeld SK, Kurochkin IV, Lareau LF, Lazarevic D, Lipovich L, Liu J, Liuni S, McWilliam S, Madan Babu M, Madera M, Marchionni L, Matsuda H, Matsuzawa S, Miki H, Mignone F, Miyake S, Morris K, Mottagui-Tabar S, Mulder N, Nakano N, Nakauchi H, Ng P, Nilsson R, Nishiguchi S, Nishikawa S, Nori F, Ohara O, Okazaki Y, Orlando V, Pang KC, Pavan WJ, Pavesi G, Pesole G, Petrovsky N, Piazza S, Reed J, Reid JF, Ring BZ, Ringwald M, Rost B, Ruan Y, Salzberg SL, Sandelin A, Schneider C, Schonbach C, Sekiguchi K, Semple CA, Seno S, Sessa L, Sheng Y, Shibata Y, Shimada H, Shimada K, Silva D, Sinclair B, Sperling S, Stupka E, Sugiura K, Sultana R, Takenaka Y, Taki K, Tammoja K, Tan SL, Tang S, Taylor MS, Tegner J, Teichmann SA, Ueda HR, van Nimwegen E, Verardo R, Wei CL, Yagi K, Yamanishi H, Zabarovsky E, Zhu S, Zimmer A, Hide W, Bult C, Grimmond SM, Teasdale RD, Liu ET, Brusic V, Quackenbush J, Wahlestedt C, Mattick JS, Hume DA, Kai C, Sasaki D, Tomaru Y, Fukuda S, Kanamori-Katayama M, Suzuki M, Aoki J, Arakawa T, Iida J, Imamura K, Itoh M, Kato T, Kawaji H, Kawagashira N, Kawashima T, Kojima M, Kondo S, Konno H, Nakano K, Ninomiya N, Nishio T, Okada M, Plessy C, Shibata K, Shiraki T, Suzuki S, Tagami M, Waki K, Watahiki A, Okamura-Oho Y, Suzuki H, Kawai J, Hayashizaki Y Science Sept. 2, 2005
Hematopoietic tissue-specific expression of mouse Neil3 for endonuclease VIII-like protein. Torisu K, Tsuchimoto D, Ohnishi Y, Nakabeppu Y J Biochem Dec. 1, 2005
Expression patterns of Neil3 during embryonic brain development and neoplasia. Hildrestrand GA, Neurauter CG, Diep DB, Castellanos CG, Krauss S, Bjoras M, Luna L BMC Neurosci Jan. 1, 2009
Human Nei-like protein NEIL3 has AP lyase activity specific for single-stranded DNA and confers oxidative stress resistance in Escherichia coli mutant. Takao M, Oohata Y, Kitadokoro K, Kobayashi K, Iwai S, Yasui A, Yonei S, Zhang QM Genes Cells Jan. 1, 2009
The mouse ortholog of NEIL3 is a functional DNA glycosylase in vitro and in vivo. Liu M, Bandaru V, Bond JP, Jaruga P, Zhao X, Christov PP, Burrows CJ, Rizzo CJ, Dizdaroglu M, Wallace SS Proc Natl Acad Sci U S A March 16, 2010


Last modification of this entry: Oct. 6, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.