|
|
Protein FULL name: DNA-(apurinic or apyrimidinic site) lyase [Mus musculus].
Apex1 (Mus musculus) is product of expression of
Apex1
gene.
FUNCTION: Repairs oxidative DNA damages in vitro. May have a role
in protection against cell lethality and suppression of mutations.
Removes the blocking groups from the 3'-termini of the DNA strand
breaks generated by ionizing radiations and bleomycin.
CATALYTIC ACTIVITY: The C-O-P bond 3' to the apurinic or
apyrimidinic site in DNA is broken by a beta-elimination reaction,
leaving a 3'-terminal unsaturated sugar and a product with a
terminal 5'-phosphate.
SUBUNIT: Monomer. Component of the SET complex, which also
contains SET, ANP32A, HMGB2 and NME1 (By similarity).
SUBCELLULAR LOCATION: Nucleus.
SIMILARITY: Belongs to the DNA repair enzymes AP/exoA family.
Links to other databases:
Protein sequence:
MPKRGKKAAADDGEEPKSEPETKKSKGAAKKTEKEAAGEGPVLYEDPPDQ
KTSPSGKSATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSE
NKLPAELQELPGLTHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGEEEH
DQEGRVIVAEFESFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKDLAS
RKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLAD
SFRHLYPNTAYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIR
SKALGSDHCPITLYLAL
|
Apex1 (Mus musculus) belongs to following protein families:
References:
|
Title
|
Authors
|
Journal
|
|
A mouse DNA repair enzyme (APEX nuclease) having exonuclease and apurinic/apyrimidinic endonuclease activities: purification and characterization.
|
Seki S, Ikeda S, Watanabe S, Hatsushika M, Tsutsui K, Akiyama K, Zhang B
|
Biochim Biophys Acta
Aug. 9, 1991
|
|
cDNA and deduced amino acid sequence of a mouse DNA repair enzyme (APEX nuclease) with significant homology to Escherichia coli exonuclease III.
|
Seki S, Akiyama K, Watanabe S, Hatsushika M, Ikeda S, Tsutsui K
|
J Biol Chem
Nov. 5, 1991
|
|
Genomic structure of the mouse apurinic/apyrimidinic endonuclease gene.
|
Takiguchi Y, Chen DJ
|
Mamm Genome
Nov. 1, 1994
|
|
Cloning, sequence analysis, and chromosomal assignment of the mouse Apex gene.
|
Akiyama K, Nagao K, Oshida T, Tsutsui K, Yoshida MC, Seki S
|
Genomics
March 1, 1995
|
|
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
|
Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J
|
Genome Res
Oct. 1, 2004
|
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|