Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Nudt1 |
Protein FULL name:
7,8-dihydro-8-oxoguanine triphosphatase [Mus musculus].
Nudt1 (Mus musculus) is product of expression of Nudt1 gene.
FUNCTION: Antimutagenic. Responsible for preventing misincorporation of 8-oxo-dGTP into DNA thus preventing A:T to C:G transversions.
CATALYTIC ACTIVITY: 8-oxo-dGTP + H(2)O = 8-oxo-dGMP + diphosphate.
SIMILARITY: Belongs to the Nudix hydrolase family.
SIMILARITY: Contains 1 nudix hydrolase domain.
| NCBI GenPept GI number(s): |
6678950 |
| Species: | Mus musculus |
Links to other databases:
| Database | ID | Link |
| Uniprot | P53368 |
P53368 |
| PFAM: | - |
P53368 (Link - using uniprot id) |
| InterPro: | - |
P53368 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MSTSRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGAK RELLEESGLSVDTLHKVGHISFEFVGSPELMDVHIFSADHVHGTPTESEE MRPQWFQLDQIPFADLWPDDSYWFPLLLQKKKFCGHFKFQDQDTILSYSL REVDSF |
Nudt1 (Mus musculus) belongs to following protein families:
References:
| Title | Authors | Journal |
| Mouse MTH1 protein with 8-oxo-7,8-dihydro-2'-deoxyguanosine 5'-triphosphatase activity that prevents transversion mutation. cDNA cloning and tissue distribution. | Kakuma T, Nishida J, Tsuzuki T, Sekiguchi M | J Biol Chem Oct. 27, 1995 |
| Organization and expression of the mouse MTH1 gene for preventing transversion mutation. | Igarashi H, Tsuzuki T, Kakuma T, Tominaga Y, Sekiguchi M | J Biol Chem Jan. 7, 1997 |
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|