Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Spo11 |
Protein FULL name:
meiotic recombination protein SPO11 isoform a [Mus musculus].
Spo11 (Mus musculus) is product of expression of Spo11 gene.
FUNCTION: Required for meiotic recombination. Mediates DNA cleavage that forms the double-strand breaks (DSB) that initiate meiotic recombination (By similarity).
SUBCELLULAR LOCATION: Nucleus (By similarity).
TISSUE SPECIFICITY: High levels are found only in the testis where expression is restricted primarily to meiotic germ cells. Not expressed in spermatogonia. Highest levels are found in pachytene spermatocytes. Very low levels are found in thymus, brain and oocytes of embryonic ovary. Not detected in adult ovary.
DEVELOPMENTAL STAGE: Not detected at day 7 postpartum (dpp). Levels are low at 12 dpp but increase by 17 dpp. High levels are maintained throughout the remainder of testis development.
SIMILARITY: Belongs to the TOP6A family.
| NCBI GenPept GI number(s): |
6755624 |
| Species: | Mus musculus |
Links to other databases:
| Database | ID | Link |
| Uniprot | Q9WTK8 |
Q9WTK8 |
| PFAM: | - |
Q9WTK8 (Link - using uniprot id) |
| InterPro: | - |
Q9WTK8 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MAFAPMGPEASFFDALDRHRASLLAMVKRGAGETPAGATRVASSSEVLTA IENIIQDIIKSLARNEVPAFTIDNRSSWENIMFDDSVGLRMIPQCTTRKI RSDSPKSVKKFALILKVLSMIYKLIQSDTYATKRDIYYTDSQLFGNQAAV DSAIDDISCMLKVPRRSLHVLSTSKGLIAGNLRYMEEDGTRVQCTCSATA TAVPTNIQGMQHLITDAKFLLIVEKDATFQRLLDDNFCSRMSPCIMVTGK GVPDLNTRLLVKKLWDTFHIPVFTLVDADPYGIEIMCIYKYGSMSMSFEA HNLTIPTIRWLGLLPSDIQRLNIPKDSLIPLTKHDQMKLDSILKRPYITY QPLWKKELEMMADSKMKAEIQALTLLSSDYLSRVYLPNKLRFGGWI |
Spo11 (Mus musculus) belongs to following protein families:
References:
| Title | Authors | Journal |
| Cloning, characterization, and localization of mouse and human SPO11. | Romanienko PJ, Camerini-Otero RD | Genomics Oct. 15, 1999 |
| A mouse homolog of the Saccharomyces cerevisiae meiotic recombination DNA transesterase Spo11p. | Keeney S, Baudat F, Angeles M, Zhou ZH, Copeland NG, Jenkins NA, Manova K, Jasin M | Genomics Oct. 15, 1999 |
| Differential gene expression of mammalian SPO11/TOP6A homologs during meiosis. | Shannon M, Richardson L, Christian A, Handel MA, Thelen MP | FEBS Lett Dec. 3, 1999 |
| Identification and characterization of an SPO11 homolog in the mouse. | Metzler-Guillemain C, de Massy B | Chromosoma Jan. 1, 2000 |
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|