Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Dclre1c |
Protein FULL name:
protein artemis isoform 2 [Mus musculus].
Dclre1c (Mus musculus) is product of expression of Dclre1c gene.
FUNCTION: Required for V(D)J recombination, the process by which exons encoding the antigen-binding domains of immunoglobulins and T-cell receptor proteins are assembled from individual V, (D), and J gene segments. V(D)J recombination is initiated by the lymphoid specific RAG endonuclease complex, which generates site specific DNA double strand breaks (DSBs). These DSBs present two types of DNA end structures: hairpin sealed coding ends and phosphorylated blunt signal ends. These ends are independently repaired by the non homologous end joining (NHEJ) pathway to form coding and signal joints respectively. This protein likely exhibits single- strand specific 5'-3' exonuclease activity in isolation, and may acquire endonucleolytic activity on 5' and 3' hairpins and overhangs when in a complex with PRKDC. The latter activity may be required specifically for the resolution of closed hairpins prior to the formation of the coding joint. May also be required for the repair of complex DSBs induced by ionizing radiation, which require substantial end-processing prior to religation by NHEJ.
SUBUNIT: Interacts with ATM, BRCA1, PRKDC and TP53BP1. Also exhibits ATM- and phosphorylation-dependent interaction with the MRN complex, composed of MRE11A/MRE11, RAD50, and NBN (By similarity).
SUBCELLULAR LOCATION: Nucleus (By similarity).
PTM: Phosphorylation on undefined residues by PRKDC may stimulate endonucleolytic activity on 5' and 3' hairpins and overhangs. PRKDC must remain present, even after phosphorylation, for efficient hairpin opening. Also phosphorylated by ATM in response to ionizing radiation (IR) and by ATR in response to ultraviolet (UV) radiation (By similarity).
SIMILARITY: Belongs to the DNA repair metallo-beta-lactamase (DRMBL) family.
| NCBI GenPept GI number(s): |
28316788 |
| Species: | Mus musculus |
Links to other databases:
| Database | ID | Link |
| Uniprot | Q8K4J0 |
Q8K4J0 |
| PFAM: | - |
Q8K4J0 (Link - using uniprot id) |
| InterPro: | - |
Q8K4J0 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MSSFQGQMAEYPTISIDRFDRENLKARAYFLSHCHKDHMKGLRAPSLKRR LECSLKVFLYCSPVTKELLLTSPKYRFWENRIITIEIETPTQISLVDEAS GEKEEVVVTLLPAGHCPGSVMFLFQGSNGTVLYTGDFRLAKGEASRMELL HSGGRVKDIQSVYLDTTFCDPRFYQIPSREQCLRGILELVRSWVTRSPHH VVWLNCKAAYGYEYLFTNLSEELGVQVHVDKLDMFKNMPDILHHLTTDRN TQIHACRHPKAEECFQWNKLPCGITSQNKTALHTISIKPSTMWFGERTRK TNVIVRTGESSYRACFSFHSSFSEIKDFLSYICPVNVYPNVIPVGLTVDK VMDVLKPLCRSPQSVEPKYKPLGKLKRARTIHLDSEEDDDLFDDPLPTPL RHKVPYQLTLQPELFSMKALPLDQPELRQSPGGCKAESVWSPSLANFIDC EESNSDSGEELETPPPSLQGGLGPSTLVQQNADPDVDIPQWEVFFKRRDE ITVDTMIRTPRPRKMKGCGQWSLKMLLQNLEIQEEKHIFENRGWKMAGQV KGSCGLLEGQSSLPTFKLATSLASNSSFWPPWHLHSHAHTQIFTFKKKTK TLL |
Dclre1c (Mus musculus) belongs to following protein families:
References:
| Title | Authors | Journal |
| Metallo-beta-lactamase fold within nucleic acids processing enzymes: the beta-CASP family. | Callebaut I, Moshous D, Mornon JP, de Villartay JP | Nucleic Acids Res Aug. 15, 2002 |
| Leaky Scid phenotype associated with defective V(D)J coding end processing in Artemis-deficient mice. | Rooney S, Sekiguchi J, Zhu C, Cheng HL, Manis J, Whitlow S, DeVido J, Foy D, Chaudhuri J, Lombard D, Alt FW | Mol Cell Dec. 1, 2002 |
| Defective DNA repair and increased genomic instability in Artemis-deficient murine cells. | Rooney S, Alt FW, Lombard D, Whitlow S, Eckersdorff M, Fleming J, Fugmann S, Ferguson DO, Schatz DG, Sekiguchi J | J Exp Med March 3, 2003 |
| Targeted disruption of the Artemis murine counterpart results in SCID and defective V(D)J recombination that is partially corrected with bone marrow transplantation. | Li L, Salido E, Zhou Y, Bhattacharyya S, Yannone SM, Dunn E, Meneses J, Feeney AJ, Cowan MJ | J Immunol Jan. 15, 2005 |
| The transcriptional landscape of the mammalian genome. | Carninci P, Kasukawa T, Katayama S, Gough J, Frith MC, Maeda N, Oyama R, Ravasi T, Lenhard B, Wells C, Kodzius R, Shimokawa K, Bajic VB, Brenner SE, Batalov S, Forrest AR, Zavolan M, Davis MJ, Wilming LG, Aidinis V, Allen JE, Ambesi-Impiombato A, Apweiler R, Aturaliya RN, Bailey TL, Bansal M, Baxter L, Beisel KW, Bersano T, Bono H, Chalk AM, Chiu KP, Choudhary V, Christoffels A, Clutterbuck DR, Crowe ML, Dalla E, Dalrymple BP, de Bono B, Della Gatta G, di Bernardo D, Down T, Engstrom P, Fagiolini M, Faulkner G, Fletcher CF, Fukushima T, Furuno M, Futaki S, Gariboldi M, Georgii-Hemming P, Gingeras TR, Gojobori T, Green RE, Gustincich S, Harbers M, Hayashi Y, Hensch TK, Hirokawa N, Hill D, Huminiecki L, Iacono M, Ikeo K, Iwama A, Ishikawa T, Jakt M, Kanapin A, Katoh M, Kawasawa Y, Kelso J, Kitamura H, Kitano H, Kollias G, Krishnan SP, Kruger A, Kummerfeld SK, Kurochkin IV, Lareau LF, Lazarevic D, Lipovich L, Liu J, Liuni S, McWilliam S, Madan Babu M, Madera M, Marchionni L, Matsuda H, Matsuzawa S, Miki H, Mignone F, Miyake S, Morris K, Mottagui-Tabar S, Mulder N, Nakano N, Nakauchi H, Ng P, Nilsson R, Nishiguchi S, Nishikawa S, Nori F, Ohara O, Okazaki Y, Orlando V, Pang KC, Pavan WJ, Pavesi G, Pesole G, Petrovsky N, Piazza S, Reed J, Reid JF, Ring BZ, Ringwald M, Rost B, Ruan Y, Salzberg SL, Sandelin A, Schneider C, Schonbach C, Sekiguchi K, Semple CA, Seno S, Sessa L, Sheng Y, Shibata Y, Shimada H, Shimada K, Silva D, Sinclair B, Sperling S, Stupka E, Sugiura K, Sultana R, Takenaka Y, Taki K, Tammoja K, Tan SL, Tang S, Taylor MS, Tegner J, Teichmann SA, Ueda HR, van Nimwegen E, Verardo R, Wei CL, Yagi K, Yamanishi H, Zabarovsky E, Zhu S, Zimmer A, Hide W, Bult C, Grimmond SM, Teasdale RD, Liu ET, Brusic V, Quackenbush J, Wahlestedt C, Mattick JS, Hume DA, Kai C, Sasaki D, Tomaru Y, Fukuda S, Kanamori-Katayama M, Suzuki M, Aoki J, Arakawa T, Iida J, Imamura K, Itoh M, Kato T, Kawaji H, Kawagashira N, Kawashima T, Kojima M, Kondo S, Konno H, Nakano K, Ninomiya N, Nishio T, Okada M, Plessy C, Shibata K, Shiraki T, Suzuki S, Tagami M, Waki K, Watahiki A, Okamura-Oho Y, Suzuki H, Kawai J, Hayashizaki Y | Science Sept. 2, 2005 |
| Lineage-specific biology revealed by a finished genome assembly of the mouse. | Church DM, Goodstadt L, Hillier LW, Zody MC, Goldstein S, She X, Bult CJ, Agarwala R, Cherry JL, DiCuccio M, Hlavina W, Kapustin Y, Meric P, Maglott D, Birtle Z, Marques AC, Graves T, Zhou S, Teague B, Potamousis K, Churas C, Place M, Herschleb J, Runnheim R, Forrest D, Amos-Landgraf J, Schwartz DC, Cheng Z, Lindblad-Toh K, Eichler EE, Ponting CP | PLoS Biol May 5, 2009 |
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|