|
Protein FULL name: single-strand selective monofunctional uracil DNA glycosylase [Mus musculus].
Smug1 (Mus musculus) is product of expression of
Smug1
gene.
FUNCTION: Responsible for recognizing base lesions in the genome
and initiating base excision DNA repair. Acts as a monofunctional
DNA glycosylase specific for uracil (U) residues in DNA and has a
preference for single-stranded DNA substrates. The activity is
greater against mismatches (U/G) than against matches (U/A).
Excised uracil (U), 5-formyluracil (fU) and uracil derivatives
bearing an oxidized group at C5 [5-hydroxyuracil (hoU) and 5-
hydroxymethyluracil (hmU)] in ssDNA and dsDNA but not analogous
cytosine derivatives (5-hydroxycytosine and 5-formylcytosine) and
other oxidized damage. The activity is damage specificity and salt
concentration-dependent. The general order of the preference for
ssDNA and dsDNA is the following: ssDNA > dsDNA (G pair) = dsDNA
(A pair) at the low salt concentration. At the high concentration
dsDNA (G pair) > dsDNA (A pair) > ssDNA (By similarity).
SUBCELLULAR LOCATION: Nucleus (By similarity).
Links to other databases:
Protein sequence:
MAASQTFPLGPTHEPASALMEPLPCTRSLAEGFLEEELRLNAELSQLQFP
EPVGVIYNPVDYAWEPHRNYVTRYCQGPKEVLFLGMNPGPFGMAQTGVPF
GEVNVVRDWLGVGGPVLTPPQEHPKRPVLGLECPQSEVSGARFWGFFRTL
CGQPQVFFRHCFVHNLCPLLFLAPSGRNLTPAELPAKQREQLLSICDAAL
CRQVQLLGVRLVVGVGRLAEQRARRALAGLTPEVQVEGLLHPSPRSAQAN
KGWEAAARERLQELGLLPLLTDEGSARPT
|
Smug1 (Mus musculus) is able to recognize following damages:
Smug1 (Mus musculus) belongs to following protein families:
References:
Title
|
Authors
|
Journal
|
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
|
Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J
|
Genome Res
Oct. 1, 2004
|
The transcriptional landscape of the mammalian genome.
|
Carninci P, Kasukawa T, Katayama S, Gough J, Frith MC, Maeda N, Oyama R, Ravasi T, Lenhard B, Wells C, Kodzius R, Shimokawa K, Bajic VB, Brenner SE, Batalov S, Forrest AR, Zavolan M, Davis MJ, Wilming LG, Aidinis V, Allen JE, Ambesi-Impiombato A, Apweiler R, Aturaliya RN, Bailey TL, Bansal M, Baxter L, Beisel KW, Bersano T, Bono H, Chalk AM, Chiu KP, Choudhary V, Christoffels A, Clutterbuck DR, Crowe ML, Dalla E, Dalrymple BP, de Bono B, Della Gatta G, di Bernardo D, Down T, Engstrom P, Fagiolini M, Faulkner G, Fletcher CF, Fukushima T, Furuno M, Futaki S, Gariboldi M, Georgii-Hemming P, Gingeras TR, Gojobori T, Green RE, Gustincich S, Harbers M, Hayashi Y, Hensch TK, Hirokawa N, Hill D, Huminiecki L, Iacono M, Ikeo K, Iwama A, Ishikawa T, Jakt M, Kanapin A, Katoh M, Kawasawa Y, Kelso J, Kitamura H, Kitano H, Kollias G, Krishnan SP, Kruger A, Kummerfeld SK, Kurochkin IV, Lareau LF, Lazarevic D, Lipovich L, Liu J, Liuni S, McWilliam S, Madan Babu M, Madera M, Marchionni L, Matsuda H, Matsuzawa S, Miki H, Mignone F, Miyake S, Morris K, Mottagui-Tabar S, Mulder N, Nakano N, Nakauchi H, Ng P, Nilsson R, Nishiguchi S, Nishikawa S, Nori F, Ohara O, Okazaki Y, Orlando V, Pang KC, Pavan WJ, Pavesi G, Pesole G, Petrovsky N, Piazza S, Reed J, Reid JF, Ring BZ, Ringwald M, Rost B, Ruan Y, Salzberg SL, Sandelin A, Schneider C, Schonbach C, Sekiguchi K, Semple CA, Seno S, Sessa L, Sheng Y, Shibata Y, Shimada H, Shimada K, Silva D, Sinclair B, Sperling S, Stupka E, Sugiura K, Sultana R, Takenaka Y, Taki K, Tammoja K, Tan SL, Tang S, Taylor MS, Tegner J, Teichmann SA, Ueda HR, van Nimwegen E, Verardo R, Wei CL, Yagi K, Yamanishi H, Zabarovsky E, Zhu S, Zimmer A, Hide W, Bult C, Grimmond SM, Teasdale RD, Liu ET, Brusic V, Quackenbush J, Wahlestedt C, Mattick JS, Hume DA, Kai C, Sasaki D, Tomaru Y, Fukuda S, Kanamori-Katayama M, Suzuki M, Aoki J, Arakawa T, Iida J, Imamura K, Itoh M, Kato T, Kawaji H, Kawagashira N, Kawashima T, Kojima M, Kondo S, Konno H, Nakano K, Ninomiya N, Nishio T, Okada M, Plessy C, Shibata K, Shiraki T, Suzuki S, Tagami M, Waki K, Watahiki A, Okamura-Oho Y, Suzuki H, Kawai J, Hayashizaki Y
|
Science
Sept. 2, 2005
|
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|