Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Chek2 |
Protein FULL name:
serine/threonine-protein kinase Chk2 [Mus musculus].
Chek2 (Mus musculus) is product of expression of Chek2 gene.
FUNCTION: Regulates cell cycle checkpoints and apoptosis in response to DNA damage, particularly to DNA double-strand breaks. Inhibits CDC25C phosphatase by phosphorylation, preventing the entry into mitosis. May also play a role in meiosis. Regulates the TP53 tumor suppressor through phosphorylation at 'Thr-20' and 'Ser-23'.
CATALYTIC ACTIVITY: ATP + a protein = ADP + a phosphoprotein.
COFACTOR: Magnesium.
ENZYME REGULATION: Rapidly phosphorylated on Thr-68 by MLTK in response to DNA damage and to replication block. Kinase activity is also up-regulated by autophosphorylation (By similarity).
SUBCELLULAR LOCATION: Nucleus.
PTM: Phosphorylated by PLK4 (By similarity).
SIMILARITY: Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. CHK2 subfamily.
SIMILARITY: Contains 1 FHA domain.
SIMILARITY: Contains 1 protein kinase domain.
| NCBI GenPept GI number(s): |
7710088 |
| Species: | Mus musculus |
Links to other databases:
| Database | ID | Link |
| Uniprot | Q9Z265 |
Q9Z265 |
| PFAM: | - |
Q9Z265 (Link - using uniprot id) |
| InterPro: | - |
Q9Z265 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MKSHHQSHSSTSSKAHDSASCSQSQGGFSQPQGTPSQLHELSQYQGSSSS STGTVPSSSQSSHSSSGTLSSLETVSTQELCSIPEDQEPEEPGPAPWARL WALQDGFSNLDCVNDNYWFGRDKSCEYCFDGPLLRRTDKYRTYSKKHFRI FREMGPKNCYIVYIEDHSGNGTFVNTELIGKGKRCPLSNNSEIALSLCRN KVFVFFDLTVDDQSVYPKELRDEYIMSKTLGSGACGEVKMAFERKTCQKV AIKIISKRRFALGSSREADTAPSVETEIEILKKLNHPCIIKIKDVFDAED YYIVLELMEGGELFDRVVGNKRLKEATCKLYFYQMLVAVQYLHENGIIHR DLKPENVLLSSQEEDCLIKITDFGQSKILGETSLMRTLCGTPTYLAPEVL VSNGTAGYSRAVDCWSLGVILFICLSGYPPFSEHKTQVSLKDQITSGKYN FIPEVWTDVSEEALDLVKKLLVVDPKARLTTEEALNHPWLQDEYMKKKFQ DLLVQEKNSVTLPVAPAQTSSQKRPLELEVEGMPSTKRLSVCGAVL |
Chek2 (Mus musculus) belongs to following protein families:
References:
| Title | Authors | Journal |
| Linkage of ATM to cell cycle regulation by the Chk2 protein kinase. | Matsuoka S, Huang M, Elledge SJ | Science Dec. 4, 1998 |
| The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J | Genome Res Oct. 1, 2004 |
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|