Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Cdk7 |
Protein FULL name:
cell division protein kinase 7 [Mus musculus].
Cdk7 (Mus musculus) is product of expression of Cdk7 gene.
FUNCTION: Cyclin-dependent kinases (CDKs) are activated by the binding to a cyclin and mediate the progression through the cell cycle. Each different complex controls a specific transition between two subsequent phases in the cell cycle. CDK7 is the catalytic subunit of the CDK-activating kinase (CAK) complex, a serine-threonine kinase. CAK activates the cyclin-associated kinases CDK1, CDK2, CDK4 and CDK6 by threonine phosphorylation. CAK complexed to the core-TFIIH basal transcription factor activates RNA polymerase II by serine phosphorylation of the repetitive C-terminus domain (CTD) of its large subunit (POLR2A), allowing its escape from the promoter and elongation of the transcripts. Involved in cell cycle control and in RNA transcription by RNA polymerase II. Its expression and activity are constant throughout the cell cycle.
CATALYTIC ACTIVITY: ATP + a protein = ADP + a phosphoprotein.
CATALYTIC ACTIVITY: ATP + [DNA-directed RNA polymerase] = ADP + [DNA-directed RNA polymerase] phosphate.
ENZYME REGULATION: Phosphorylation at Thr-170 is required for enzymatic activity (By similarity).
SUBUNIT: Associates primarily with cyclin H and MAT1 to form the CAK complex. CAK can further associate with the core-TFIIH to form the TFIIH basal transcription factor. Interacts with PUF60 (By similarity).
SUBCELLULAR LOCATION: Nucleus.
SIMILARITY: Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.
SIMILARITY: Contains 1 protein kinase domain.
| NCBI GenPept GI number(s): |
160333726 |
| Species: | Mus musculus |
Links to other databases:
| Database | ID | Link |
| Uniprot | Q03147 |
Q03147 |
| PFAM: | - |
Q03147 (Link - using uniprot id) |
| InterPro: | - |
Q03147 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MAVDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSE AKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEV IIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGV LKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVG CILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFK SFPGVPLQHIFIAAGDDLLELIQGLFLFNPCTRTTASQALKTKYFSNRPG PTPGCQLPRPNCPVEALKEPANPTVATKRKRAEALEQGILPKKLIF |
Cdk7 (Mus musculus) belongs to following protein families:
References:
| Title | Authors | Journal |
| [Identification of new protein kinase genes, similar to kinases of the cdc2 family and expressed in murine hematopoietic stem cells] | Ershler MA, Nagorskaia TV, Fisser IaV, Beliavskii AV | Dokl Akad Nauk Jan. 1, 1992 |
| An Eph-related receptor protein tyrosine kinase gene segmentally expressed in the developing mouse hindbrain. | Gilardi-Hebenstreit P, Nieto MA, Frain M, Mattei MG, Chestier A, Wilkinson DG, Charnay P | Oncogene Dec. 1, 1992 |
| Novel CDC2-related protein kinases produced in murine hematopoietic stem cells. | Ershler M, Nagorskaya TV, Visser JW, Belyavsky AV | Gene Jan. 28, 1993 |
| Activation of cyclin-dependent kinase 4 (cdk4) by mouse MO15-associated kinase. | Matsuoka M, Kato JY, Fisher RP, Morgan DO, Sherr CJ | Mol Cell Biol Nov. 1, 1994 |
| Sequence of the cDNA encoding murine CRK4 protein kinase. | Stepanova LYu, Ershler MA, Belyavsky AV | Gene Nov. 18, 1994 |
| The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J | Genome Res Oct. 1, 2004 |
| Solid tumor proteome and phosphoproteome analysis by high resolution mass spectrometry. | Zanivan S, Gnad F, Wickstrom SA, Geiger T, Macek B, Cox J, Fassler R, Mann M | J Proteome Res Dec. 1, 2008 |
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|