Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Rpa2 |
Protein FULL name:
replication protein A 32 kDa subunit [Mus musculus].
Rpa2 (Mus musculus) is product of expression of Rpa2 gene.
FUNCTION: Required for DNA recombination, repair and replication. The activity of RP-A is mediated by single-stranded DNA binding and protein interactions.
SUBUNIT: Heterotrimer of 70, 32, and 14 kDa chains. The DNA- binding activity may reside exclusively on the 70 kDa subunit. Binds to SERTAD3/RBT1 (By similarity). Interacts with TIPIN.
SUBCELLULAR LOCATION: Nucleus (By similarity). Note=Also present in PML nuclear bodies. Redistributes to discrete nuclear foci upon DNA damage (By similarity).
PTM: Phosphorylated in a cell-cycle-dependent manner (from the S phase until mitosis). Phosphorylated upon DNA damage, which promotes its translocation to nuclear foci (By similarity).
| NCBI GenPept GI number(s): |
110625961 |
| Species: | Mus musculus |
Links to other databases:
| Database | ID | Link |
| Uniprot | Q62193 |
Q62193 |
| PFAM: | - |
Q62193 (Link - using uniprot id) |
| InterPro: | - |
Q62193 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MWNSGFESFSSSTYGGAGGYTQSPGGFGSPTPSQAEKKSRVRAQHIVPCT ISQLLSATLTDEVFRIGDVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAP PMDVRQWVDTDDASGENAVVPPETYVKVAGHLRSFQNKKSLVAFKIIPLE DMNEFTAHILEVVNSHMMLSKPNSQASAGRPSMSNPGMSEPGNFSGNNFM PANGLTVVQNQVLNLIKACPRPEGLNFQDLRSQLQHMPVPSIKQAVDFLC NEGHIYSTVDDDHFKSTDAE |
Rpa2 (Mus musculus) belongs to following protein families:
References:
| Title | Authors | Journal |
| cDNA cloning of the murine 30-kDa protein homologous to the 32-kDa subunit of human replication protein A. | Nakagawa M, Tsukada S, Soma T, Shimizu Y, Miyake S, Iwamatsu A, Sugiyama H | Nucleic Acids Res Aug. 11, 1991 |
| Mammalian TIMELESS and Tipin are evolutionarily conserved replication fork-associated factors. | Gotter AL, Suppa C, Emanuel BS | J Mol Biol Jan. 9, 2007 |
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|