Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Dpb2p |
Protein FULL name:
DNA polymerase epsilon subunit B, DNA polymerase II subunit 2
Dpb2p (Saccharomyces cerevisiae) is product of expression of DPB2 gene.
Dpb2p is involved in:
MMR in Saccharomyces cerevisiae
Keywords:
- mismatch repair (MMR)
- transcription-coupled repair NER (TCR-NER)
- nucleotide excision repair (NER)
- base excision repair (BER)
- homologous recombination repair (HRR)
- global genome repair NER (GGR-NER)
FUNCTION: DNA polymerase epsilon (DNA polymerase II) participates in chromosomal DNA replication. It is required during synthesis of the leading and lagging DNA strands at the replication fork and binds at/or near replication origins and moves along DNA with the replication fork. It has 3'-5' proofreading exonuclease activity that correct errors arising during DNA replication. It is also involved in DNA synthesis during DNA repair.
CATALYTIC ACTIVITY: Deoxynucleoside triphosphate + DNA(n) = diphosphate + DNA(n+1).
SUBUNIT: DNA polymerase epsilon is a heterotetramer consisting of POL2, DPB2, DPB3 and DPB4.
SUBCELLULAR LOCATION: Cytoplasm. Nucleus.
PTM: Phosphorylated in a cell cycle dependent manner during late G1 phase. Phosphorylation may facilitate the interaction with POL2 or the activity of DNA polymerase II. Phosphorylation is independent of DNA replication but dependent upon CDC28 in vivo. Both Ser-141 and Ser-613 are phosphorylated in vivo, but in vitro only Ser-141 is phosphorylated by CDC28.
MISCELLANEOUS: Present with 3110 +/- 251 molecules/cell in log phase SD medium.
MISCELLANEOUS: In eukaryotes there are five DNA polymerases: alpha, beta, gamma, delta, and epsilon which are responsible for different reactions of DNA synthesis.
SIMILARITY: Belongs to the DNA polymerase epsilon subunit B family.
SEQUENCE CAUTION: Sequence=AAA34576.1; Type=Erroneous initiation; Sequence=AAB68109.1; Type=Erroneous initiation;
| NCBI GenPept GI number(s): |
85681935 |
| Species: | Saccharomyces cerevisiae |
Links to other databases:
| Database | ID | Link |
| Uniprot | P24482 |
P24482 |
| PFAM: |
PF04042 |
PF04042 |
| InterPro: |
IPR007185 |
IPR007185 |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MFGSGNVLPVKIQPPLLRPLAYRVLSRKYGLSIKSDGLSALAEFVGTNIG ANWRQGPATIKFLEQFAAVWKQQERGLFIDQSGVKEVIQEMKEREKVEWS HEHPIQHEENILGRTDDDENNSDDEMPIAADSSLQNVSLSSPMRQPTERD EYKQPFKPESSKALDWRDYFKVINASQQQRFSYNPHKMQFIFVPNKKQNG LGGIAGFLPDIEDKVQMFLTRYYLTNDRVMRNENFQNSDMFNPLSSMVSL QNELSNTNRQQQSSSMSITPIKNLLGRDAQNFLLLGLLNKNFKGNWSLED PSGSVEIDISQTIPTQGHYYVPGCMVLVEGIYYSVGNKFHVTSMTLPPGE RREITLETIGNLDLLGIHGISNNNFIARLDKDLKIRLHLLEKELTDHKFV ILGANLFLDDLKIMTALSKILQKLNDDPPTLLIWQGSFTSVPVFASMSSR NISSSTQFKNNFDALATLLSRFDNLTENTTMIFIPGPNDLWGSMVSLGAS GTLPQDPIPSAFTKKINKVCKNVVWSSNPTRIAYLSQEIVIFRDDLSGRF KRHRLEFPFNESEDVYTENDNMMSKDTDIVPIDELVKEPDQLPQKVQETR KLVKTILDQGHLSPFLDSLRPISWDLDHTLTLCPIPSTMVLCDTTSAQFD LTYNGCKVINPGSFIHNRRARYMEYVPSSKKTIQEEIYI |
Dpb2p (Saccharomyces cerevisiae) belongs to following protein families:
References:
| Title | Authors | Journal |
| DPB2, the gene encoding DNA polymerase II subunit B, is required for chromosome replication in Saccharomyces cerevisiae. | Araki H, Hamatake RK, Johnston LH, Sugino A | Proc Natl Acad Sci U S A June 1, 1991 |
| The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI. | Bussey H, Storms RK, Ahmed A, Albermann K, Allen E, Ansorge W, Araujo R, Aparicio A, Barrell B, Badcock K, Benes V, Botstein D, Bowman S, Bruckner M, Carpenter J, Cherry JM, Chung E, Churcher C, Coster F, Davis K, Davis RW, Dietrich FS, Delius H, DiPaolo T, Hani J, et al. | Nature May 1, 1997 |
| Structure and function of the fourth subunit (Dpb4p) of DNA polymerase epsilon in Saccharomyces cerevisiae. | Ohya T, Maki S, Kawasaki Y, Sugino A | Nucleic Acids Res Oct. 15, 2000 |
| Fidelity of DNA polymerase epsilon holoenzyme from budding yeast Saccharomyces cerevisiae. | Shimizu K, Hashimoto K, Kirchner JM, Nakai W, Nishikawa H, Resnick MA, Sugino A | J Biol Chem Oct. 4, 2002 |
| The quaternary structure of DNA polymerase epsilon from Saccharomyces cerevisiae. | Chilkova O, Jonsson BH, Johansson E | J Biol Chem April 18, 2003 |
| Sequencing and comparison of yeast species to identify genes and regulatory elements. | Kellis M, Patterson N, Endrizzi M, Birren B, Lander ES | Nature May 15, 2003 |
| Global analysis of protein expression in yeast. | Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS | Nature Oct. 16, 2003 |
| Global analysis of protein localization in budding yeast. | Huh WK, Falvo JV, Gerke LC, Carroll AS, Howson RW, Weissman JS, O'Shea EK | Nature Oct. 16, 2003 |
| Cell cycle-dependent phosphorylation of the DNA polymerase epsilon subunit, Dpb2, by the Cdc28 cyclin-dependent protein kinase. | Kesti T, McDonald WH, Yates JR 3rd, Wittenberg C | J Biol Chem April 2, 2004 |
Last modification of this entry: Oct. 19, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|