Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
RECQL3 |
Protein FULL name:
DNA Helicase [Arabidopsis thaliana].
RECQL3 (Arabidopsis thaliana) is product of expression of RecQl3 gene.
FUNCTION: 3'-5' DNA helicase that may play a role in the repair of DNA. Exhibits an ATP or dATP-dependent DNA-helicase activity. Can not use GTP/dGTP, CTP/dCTP or UTP/dUTP as nucleotide cofactors. Catalyzes DNA strand annealing. On nicked Holliday junctions, unwinds the lagging strand. Can not act on intact Holliday junctions.
CATALYTIC ACTIVITY: ATP + H(2)O = ADP + phosphate.
COFACTOR: Magnesium or manganese (By similarity).
SUBCELLULAR LOCATION: Nucleus (By similarity).
TISSUE SPECIFICITY: Expressed in roots, seedlings, young leaves, shoots, shoot apical mersitem, inflorescences, flowers, siliques and seeds.
SIMILARITY: Belongs to the helicase family. RecQ subfamily.
SIMILARITY: Contains 1 helicase ATP-binding domain.
SIMILARITY: Contains 1 helicase C-terminal domain.
SEQUENCE CAUTION: Sequence=BAF01028.1; Type=Erroneous initiation; Note=Translation N-terminally extended; Sequence=CAA20044.1; Type=Erroneous gene model prediction; Note=The predicted gene At4g35740 has been split into 2 genes: At4g35733 and At4g35740; Sequence=CAB81483.1; Type=Erroneous gene model prediction; Note=The predicted gene At4g35740 has been split into 2 genes: At4g35733 and At4g35740;
| NCBI GenPept GI number(s): |
11121447 |
| Species: | Arabidopsis thaliana |
Links to other databases:
| Database | ID | Link |
| Uniprot | Q9FT72 |
Q9FT72 |
| PFAM: | - |
Q9FT72 (Link - using uniprot id) |
| InterPro: |
IPR001650 IPR004589 IPR011545 |
IPR001650 IPR004589 IPR011545 |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MKKSPLPVQNVQSSDKNVAGKEALVKLLRWHFGHADFRGKQLEAIQAVVS GRDCFCLMPTGGGKSICYQIPALAKPGIVLVVSPLIALMENQVMALKEKG IAAEYLSSTQATHVKNKIHEDLDSGKPSVRLLYVTPELIATKGFMLKLRK LHSRGLLNLIAIDEAHCISSWGHDFRPSYRQLSTLRDSLADVPVLALTAT AAPKVQKDVIDSLNLRNPLVLKSSFNRPNIFYEVRYKDLLDNAYTDLGNL LKSCGNICAIIYCLERTTCDDLSVHLSSIGISSAAYHAGLNSKMRSTVLD DWLSSKKQIIVATVAFGMGIDKKDVRMVCHFNIPKSMESFYQESGRAGRD QLPSRSVLYYGVDDRKKMEYLLRNSENKKSSSSKKPTSDFEQIVTYCEGS GCRRKKILESFGEEFPVQQCKKTCDACKHPNQVAHCLEELMTTASRRHNS SRIFITSSNNKTNEGQYSEFWNRNEDGSNSNEEISDSDDATEAANSVTGP KLSKKLGLDEKLVLLEQAEEKYYERNKQVKKSEKNAISEALRDSSKQRLL DALTRVLQLLACVEEIDSQKGSEFLENECYRKYSKAGKSFYYSQIASTVR WLGTASRDELMTRLSSVVSLAREQEPLEEPLLATEPVENIEEEDDGKTNT VESRVDEPTQELVVSPILSPIRLPQVPSFSEFVNRRKIKQNTLIDKSSEG FDDKKPAKIMKLQ |
References:
| Title | Authors | Journal |
| Sequence and analysis of chromosome 4 of the plant Arabidopsis thaliana. | Mayer K, Schuller C, Wambutt R, Murphy G, Volckaert G, Pohl T, Dusterhoft A, Stiekema W, Entian KD, Terryn N, Harris B, Ansorge W, Brandt P, Grivell L, Rieger M, Weichselgartner M, de Simone V, Obermaier B, Mache R, Muller M, Kreis M, Delseny M, Puigdomenech P, Watson M, Schmidtheini T, Reichert B, Portatelle D, Perez-Alonso M, Boutry M, Bancroft I, Vos P, Hoheisel J, Zimmermann W, Wedler H, Ridley P, Langham SA, McCullagh B, Bilham L, Robben J, Van der Schueren J, Grymonprez B, Chuang YJ, Vandenbussche F, Braeken M, Weltjens I, Voet M, Bastiaens I, Aert R, Defoor E, Weitzenegger T, Bothe G, Ramsperger U, Hilbert H, Braun M, Holzer E, Brandt A, Peters S, van Staveren M, Dirske W, Mooijman P, Klein Lankhorst R, Rose M, Hauf J, Kotter P, Berneiser S, Hempel S, Feldpausch M, Lamberth S, Van den Daele H, De Keyser A, Buysshaert C, Gielen J, Villarroel R, De Clercq R, Van Montagu M, Rogers J, Cronin A, Quail M, Bray-Allen S, Clark L, Doggett J, Hall S, Kay M, Lennard N, McLay K, Mayes R, Pettett A, Rajandream MA, Lyne M, Benes V, Rechmann S, Borkova D, Blocker H, Scharfe M, Grimm M, Lohnert TH, Dose S, de Haan M, Maarse A, Schafer M, Muller-Auer S, Gabel C, Fuchs M, Fartmann B, Granderath K, Dauner D, Herzl A, Neumann S, Argiriou A, Vitale D, Liguori R, Piravandi E, Massenet O, Quigley F, Clabauld G, Mundlein A, Felber R, Schnabl S, Hiller R, Schmidt W, Lecharny A, Aubourg S, Chefdor F, Cooke R, Berger C, Montfort A, Casacuberta E, Gibbons T, Weber N, Vandenbol M, Bargues M, Terol J, Torres A, Perez-Perez A, Purnelle B, Bent E, Johnson S, Tacon D, Jesse T, Heijnen L, Schwarz S, Scholler P, Heber S, Francs P, Bielke C, Frishman D, Haase D, Lemcke K, Mewes HW, Stocker S, Zaccaria P, Bevan M, Wilson RK, de la Bastide M, Habermann K, Parnell L, Dedhia N, Gnoj L, Schutz K, Huang E, Spiegel L, Sehkon M, Murray J, Sheet P, Cordes M, Abu-Threideh J, Stoneking T, Kalicki J, Graves T, Harmon G, Edwards J, Latreille P, Courtney L, Cloud J, Abbott A, Scott K, Johnson D, Minx P, Bentley D, Fulton B, Miller N, Greco T, Kemp K, Kramer J, Fulton L, Mardis E, Dante M, Pepin K, Hillier L, Nelson J, Spieth J, Ryan E, Andrews S, Geisel C, Layman D, Du H, Ali J, Berghoff A, Jones K, Drone K, Cotton M, Joshu C, Antonoiu B, Zidanic M, Strong C, Sun H, Lamar B, Yordan C, Ma P, Zhong J, Preston R, Vil D, Shekher M, Matero A, Shah R, Swaby IK, O'Shaughnessy A, Rodriguez M, Hoffmann J, Till S, Granat S, Shohdy N, Hasegawa A, Hameed A, Lodhi M, Johnson A, Chen E, Marra M, Martienssen R, McCombie WR | Nature Dec. 16, 1999 |
| Molecular characterisation of RecQ homologues in Arabidopsis thaliana. | Hartung F, Plchova H, Puchta H | Nucleic Acids Res Nov. 1, 2000 |
| Arabidopsis RecQsim, a plant-specific member of the RecQ helicase family, can suppress the MMS hypersensitivity of the yeast sgs1 mutant. | Bagherieh-Najjar MB, de Vries OM, Kroon JT, Wright EL, Elborough KM, Hille J, Dijkwel PP | Plant Mol Biol May 1, 2003 |
| The RecQ gene family in plants. | Hartung F, Puchta H | J Plant Physiol Jan. 1, 2006 |
| Biochemical characterization of AtRECQ3 reveals significant differences relative to other RecQ helicases. | Kobbe D, Blanck S, Focke M, Puchta H | Plant Physiol Nov. 1, 2009 |
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|