Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
ALKBH2 |
Protein FULL name:
alpha-ketoglutarate-dependent dioxygenase alkB homolog 2 [Homo sapiens].
ALKBH2 (Homo sapiens) is product of expression of ALKBH2 gene.
ALKBH2 is involved in:
DRR in Homo sapiens
Keywords:
FUNCTION: Dioxygenase that repairs alkylated DNA and RNA containing 1-methyladenine and 3-methylcytosine by oxidative demethylation. Can also repair alkylated DNA containing 1- ethenoadenine (in vitro). Has strong preference for double- stranded DNA. Has low efficiency with single-stranded substrates. Requires molecular oxygen, alpha-ketoglutarate and iron.
COFACTOR: Binds 1 Fe(2+) ion per subunit.
ENZYME REGULATION: Activated by ascorbate and magnesium ions.
SUBCELLULAR LOCATION: Nucleus. Note=Detected in replication foci during S-phase.
TISSUE SPECIFICITY: Detected in colon, small intestine, ovary, testis, prostate, skeletal muscle, heart, liver and urinary bladder.
SIMILARITY: Belongs to the alkB family.
SIMILARITY: Contains 1 Fe2OG dioxygenase domain.
| NCBI GenPept GI number(s): |
48717226 |
| Species: | Homo sapiens |
Links to other databases:
| Database | ID | Link |
| Uniprot | Q6NS38 |
Q6NS38 |
| PFAM: | - |
Q6NS38 (Link - using uniprot id) |
| InterPro: | - |
Q6NS38 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MDRFLVKGAQGGLLRKQEEQEPTGEEPAVLGGDKESTRKRPRREAPGNGG HSAGPSWRHIRAEGLDCSYTVLFGKAEADEIFQELEKEVEYFTGALARVQ VFGKWHSVPRKQATYGDAGLTYTFSGLTLSPKPWIPVLERIRDHVSGVTG QTFNFVLINRYKDGCDHIGEHRDDERELAPGSPIASVSFGACRDFVFRHK DSRGKSPSRRVAVVRLPLAHGSLLMMNHPTNTHWYHSLPVRKKVLAPRVN LTFRKILLTKK |
ALKBH2 (Homo sapiens) is able to recognize following damages:
ALKBH2 (Homo sapiens) belongs to following protein families:
References:
| Title | Authors | Journal |
| Reversal of DNA alkylation damage by two human dioxygenases. | Duncan T, Trewick SC, Koivisto P, Bates PA, Lindahl T, Sedgwick B | Proc Natl Acad Sci U S A Dec. 24, 2002 |
| Human and bacterial oxidative demethylases repair alkylation damage in both RNA and DNA. | Aas PA, Otterlei M, Falnes PO, Vagbo CB, Skorpen F, Akbari M, Sundheim O, Bjoras M, Slupphaug G, Seeberg E, Krokan HE | Nature Jan. 20, 2003 |
| The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J | Genome Res Oct. 1, 2004 |
| Repair of methylation damage in DNA and RNA by mammalian AlkB homologues. | Lee DH, Jin SG, Cai S, Chen Y, Pfeifer GP, O'Connor TR | J Biol Chem Nov. 25, 2005 |
| Crystal structures of DNA/RNA repair enzymes AlkB and ABH2 bound to dsDNA. | Yang CG, Yi C, Duguid EM, Sullivan CT, Jian X, Rice PA, He C | Nature April 24, 2008 |
| AlkB homologue 2-mediated repair of ethenoadenine lesions in mammalian DNA. | Ringvoll J, Moen MN, Nordstrand LM, Meira LB, Pang B, Bekkelund A, Dedon PC, Bjelland S, Samson LD, Falnes PO, Klungland A | Cancer Res June 1, 2008 |
| Structure determination of DNA methylation lesions N1-meA and N3-meC in duplex DNA using a cross-linked protein-DNA system. | Lu L, Yi C, Jian X, Zheng G, He C | Nucleic Acids Res July 1, 2010 |
Last modification of this entry: Nov. 14, 2020.
Add your own comment!
There is no comment yet.
|
|
|
|