Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
XseA |
Protein FULL name:
exonuclease VII large subunit [Escherichia coli].
XseA (Escherichia coli strain K-12 substr. MG1655) is product of expression of xseA gene.
FUNCTION: Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. It can also degrade 3' or 5' ss regions extending from the termini of duplex DNA molecules and displaced ss regions.
CATALYTIC ACTIVITY: Exonucleolytic cleavage in either 5'- to 3'- or 3'- to 5'-direction to yield nucleoside 5'-phosphates.
SUBUNIT: Heterooligomer composed of two different subunits with an approximate ratio of 4 small subunits for 1 large.
INTERACTION: P76168:intQ; NbExp=1; IntAct=EBI-559703, EBI-559711; P45549:yhfW; NbExp=1; IntAct=EBI-559703, EBI-1132637;
SUBCELLULAR LOCATION: Cytoplasm.
SIMILARITY: Belongs to the xseA family.
| NCBI GenPept GI number(s): |
148275 |
| Species: | Escherichia coli |
Links to other databases:
| Database | ID | Link |
| Uniprot | P04994 |
P04994 |
| PFAM: | - |
P04994 (Link - using uniprot id) |
| InterPro: | - |
P04994 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MLPSQSPAIFTVSRLNQTVRLLLEHEMGQVWISGEISNFTQPASGHWYFT LKDDTAQVRCAMFRNSSRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVE SMQPAGEGLLQQKYEQLKAKLQAEGLFDQQYKKPLPSPAHCVGVITSKTG AALHDILHVLKRRDPSLPVIIYPAAVQGDDAPGQIVRAIELANQRNECDV LIVGRGGGSLEDLWSFNDERVARAIFTSRIPVVSAVGHETDVTIADFVAD LRAPTPSAAAEVVSRNQQELLRQVQSTRQRLEMAMDYYLANRTRRFTQIH HRLQQQHPQLRLARQQTMLERLQKRMSFALENQLKRTGQQQQRLTQRLNQ QNPQPKIHRAQTRIQQLEYRLAETLRAQLSATRERFGNAVTHLEAVSPLS TLARGYSVTTATDGNVLKKVKQVKAGEMLTTRLEDGWIESEVKNIQPVKK SRKKVH |
References:
| Title | Authors | Journal |
| Subunit structure of Escherichia coli exonuclease VII. | Vales LD, Rabin BA, Chase JW | J Biol Chem Aug. 10, 1982 |
| Escherichia coli exonuclease VII. Cloning and sequencing of the gene encoding the large subunit (xseA). | Chase JW, Rabin BA, Murphy JB, Stone KL, Williams KR | J Biol Chem Nov. 15, 1986 |
| Construction of a contiguous 874-kb sequence of the Escherichia coli -K12 genome corresponding to 50.0-68.8 min on the linkage map and analysis of its sequence features. | Yamamoto Y, Aiba H, Baba T, Hayashi K, Inada T, Isono K, Itoh T, Kimura S, Kitagawa M, Makino K, Miki T, Mitsuhashi N, Mizobuchi K, Mori H, Nakade S, Nakamura Y, Nashimoto H, Oshima T, Oyama S, Saito N, Sampei G, Satoh Y, Sivasundaram S, Tagami H, Horiuchi T, et al. | DNA Res April 28, 1997 |
| The complete genome sequence of Escherichia coli K-12. | Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y | Science Sept. 5, 1997 |
| Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. | Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T | Mol Syst Biol Jan. 1, 2006 |
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|