|
|
Protein FULL name: alkB [Escherichia coli].
AlkB (Escherichia coli strain K-12 substr. MG1655) is product of expression of
alkB
gene.
AlkB is involved in:
DRR in Escherichia coli strain K-12 substr. MG1655
Keywords:
FUNCTION: Dioxygenase that repairs alkylated DNA and RNA
containing 3-methylcytosine or 1-methyladenine by oxidative
demethylation. Has highest activity towards 3-methylcytosine. Has
lower activity towards alkylated DNA containing ethenoadenine, and
no detectable activity towards 1-methylguanine or 3-methylthymine.
Accepts double-stranded and single-stranded substrates. Requires
molecular oxygen, alpha-ketoglutarate and iron. Provides extensive
resistance to alkylating agents such as MMS and DMS (SN2 agents),
but not to MMNG and MNU (SN1 agents).
COFACTOR: Binds 1 Fe(2+) ion per subunit.
SIMILARITY: Belongs to the alkB family.
SIMILARITY: Contains 1 Fe2OG dioxygenase domain.
Links to other databases:
Protein sequence:
MLDLFADAEPWQEPLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMV
TPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLC
QRAATAAGYPDFQPDACLINRYAPGAKLSLHQDKDEPDLRAPIVSVSLGL
PAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLT
IDCRYNLTFRQAGKKE
|
AlkB (Escherichia coli strain K-12 substr. MG1655) is able to recognize following damages:
References:
|
Title
|
Authors
|
Journal
|
|
Active site and complete sequence of the suicidal methyltransferase that counters alkylation mutagenesis.
|
Demple B, Sedgwick B, Robins P, Totty N, Waterfield MD, Lindahl T
|
Proc Natl Acad Sci U S A
May 1, 1985
|
|
Structure and expression of the alkB gene of Escherichia coli related to the repair of alkylated DNA.
|
Kondo H, Nakabeppu Y, Kataoka H, Kuhara S, Kawabata S, Sekiguchi M
|
J Biol Chem
Nov. 25, 1986
|
|
The Escherichia coli AlkB protein protects human cells against alkylation-induced toxicity.
|
Chen BJ, Carroll P, Samson L
|
J Bacteriol
Oct. 1, 1994
|
|
A 460-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 40.1-50.0 min region on the linkage map.
|
Itoh T, Aiba H, Baba T, Hayashi K, Inada T, Isono K, Kasai H, Kimura S, Kitakawa M, Kitagawa M, Makino K, Miki T, Mizobuchi K, Mori H, Mori T, Motomura K, Nakade S, Nakamura Y, Nashimoto H, Nishio Y, Oshima T, Saito N, Sampei G, Seki Y, Horiuchi T, et al.
|
DNA Res
Dec. 31, 1996
|
|
The complete genome sequence of Escherichia coli K-12.
|
Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y
|
Science
Sept. 5, 1997
|
|
Human and bacterial oxidative demethylases repair alkylation damage in both RNA and DNA.
|
Aas PA, Otterlei M, Falnes PO, Vagbo CB, Skorpen F, Akbari M, Sundheim O, Bjoras M, Slupphaug G, Seeberg E, Krokan HE
|
Nature
Jan. 20, 2003
|
|
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.
|
Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T
|
Mol Syst Biol
Jan. 1, 2006
|
|
Crystal structures of catalytic complexes of the oxidative DNA/RNA repair enzyme AlkB.
|
Yu B, Edstrom WC, Benach J, Hamuro Y, Weber PC, Gibney BR, Hunt JF
|
Nature
Jan. 16, 2006
|
|
Crystal structures of DNA/RNA repair enzymes AlkB and ABH2 bound to dsDNA.
|
Yang CG, Yi C, Duguid EM, Sullivan CT, Jian X, Rice PA, He C
|
Nature
April 24, 2008
|
|
Enzymological and structural studies of the mechanism of promiscuous substrate recognition by the oxidative DNA repair enzyme AlkB.
|
Yu B, Hunt JF
|
Proc Natl Acad Sci U S A
Aug. 25, 2009
|
Last modification of this entry: Nov. 14, 2020.
Add your own comment!
There is no comment yet.
|