Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
AlkB |
Protein FULL name:
alkB [Escherichia coli].
AlkB (Escherichia coli strain K-12 substr. MG1655) is product of expression of alkB gene.
AlkB is involved in:
DRR in Escherichia coli strain K-12 substr. MG1655
Keywords:
FUNCTION: Dioxygenase that repairs alkylated DNA and RNA containing 3-methylcytosine or 1-methyladenine by oxidative demethylation. Has highest activity towards 3-methylcytosine. Has lower activity towards alkylated DNA containing ethenoadenine, and no detectable activity towards 1-methylguanine or 3-methylthymine. Accepts double-stranded and single-stranded substrates. Requires molecular oxygen, alpha-ketoglutarate and iron. Provides extensive resistance to alkylating agents such as MMS and DMS (SN2 agents), but not to MMNG and MNU (SN1 agents).
COFACTOR: Binds 1 Fe(2+) ion per subunit.
SIMILARITY: Belongs to the alkB family.
SIMILARITY: Contains 1 Fe2OG dioxygenase domain.
| NCBI GenPept GI number(s): |
405945 |
| Species: | Escherichia coli |
Links to other databases:
| Database | ID | Link |
| Uniprot | P05050 |
P05050 |
| PFAM: | - |
P05050 (Link - using uniprot id) |
| InterPro: | - |
P05050 (Link - using uniprot id) |
| CATH: | None | |
| SCOP: | None | |
| PDB: | - | - |
Protein sequence:
|
MLDLFADAEPWQEPLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMV TPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLC QRAATAAGYPDFQPDACLINRYAPGAKLSLHQDKDEPDLRAPIVSVSLGL PAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLT IDCRYNLTFRQAGKKE |
AlkB (Escherichia coli strain K-12 substr. MG1655) is able to recognize following damages:
References:
| Title | Authors | Journal |
| Active site and complete sequence of the suicidal methyltransferase that counters alkylation mutagenesis. | Demple B, Sedgwick B, Robins P, Totty N, Waterfield MD, Lindahl T | Proc Natl Acad Sci U S A May 1, 1985 |
| Structure and expression of the alkB gene of Escherichia coli related to the repair of alkylated DNA. | Kondo H, Nakabeppu Y, Kataoka H, Kuhara S, Kawabata S, Sekiguchi M | J Biol Chem Nov. 25, 1986 |
| The Escherichia coli AlkB protein protects human cells against alkylation-induced toxicity. | Chen BJ, Carroll P, Samson L | J Bacteriol Oct. 1, 1994 |
| A 460-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 40.1-50.0 min region on the linkage map. | Itoh T, Aiba H, Baba T, Hayashi K, Inada T, Isono K, Kasai H, Kimura S, Kitakawa M, Kitagawa M, Makino K, Miki T, Mizobuchi K, Mori H, Mori T, Motomura K, Nakade S, Nakamura Y, Nashimoto H, Nishio Y, Oshima T, Saito N, Sampei G, Seki Y, Horiuchi T, et al. | DNA Res Dec. 31, 1996 |
| The complete genome sequence of Escherichia coli K-12. | Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y | Science Sept. 5, 1997 |
| Human and bacterial oxidative demethylases repair alkylation damage in both RNA and DNA. | Aas PA, Otterlei M, Falnes PO, Vagbo CB, Skorpen F, Akbari M, Sundheim O, Bjoras M, Slupphaug G, Seeberg E, Krokan HE | Nature Jan. 20, 2003 |
| Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. | Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T | Mol Syst Biol Jan. 1, 2006 |
| Crystal structures of catalytic complexes of the oxidative DNA/RNA repair enzyme AlkB. | Yu B, Edstrom WC, Benach J, Hamuro Y, Weber PC, Gibney BR, Hunt JF | Nature Jan. 16, 2006 |
| Crystal structures of DNA/RNA repair enzymes AlkB and ABH2 bound to dsDNA. | Yang CG, Yi C, Duguid EM, Sullivan CT, Jian X, Rice PA, He C | Nature April 24, 2008 |
| Enzymological and structural studies of the mechanism of promiscuous substrate recognition by the oxidative DNA repair enzyme AlkB. | Yu B, Hunt JF | Proc Natl Acad Sci U S A Aug. 25, 2009 |
Last modification of this entry: Nov. 14, 2020.
Add your own comment!
There is no comment yet.
|
|
|
|