Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
COPS5 |
Protein FULL name:
COP9 signalosome complex subunit 5, Jun activation domain-binding protein 1.,
Protein SHORT name:
Signalosome subunit 5 SGN5
COPS5 (Homo sapiens) is product of expression of COPS5 gene.
COPS5 is involved in:
DDS in Homo sapiens
FUNCTION: Probable protease subunit of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of the SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and ICSBP, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively. In the complex, it probably acts as the catalytic center that mediates the cleavage of Nedd8 from cullins. It however has no metalloprotease activity by itself and requires the other subunits of the CSN complex. Interacts directly with a large number of proteins that are regulated by the CSN complex, confirming a key role in the complex.
COFACTOR: Divalent metal ions (By similarity).
SUBUNIT: Component of the CSN complex, composed of COPS1/GPS1, COPS2, COPS3, COPS4, COPS5, COP6, COPS7 (COPS7A or COPS7B) and COPS8. In the complex, it probably interacts directly with COPS1, COPS2, COPS4, COPS6 and COPS7 (COPS7A or COPS7B). The CSN complex interacts with the BRISC complex. Also exists as monomeric form. Interacts with TP53, MIF, JUN, UCHL1, NCOA1, HIF1A, CDKN1B, BCL3, GFER, PGR, LHCGR, SMAD4, SMAD7, ID1, ID3, ITGB2 and TOP2A. Part of a complex consisting of RANBP9, Ran, DYRK1B and COPS5.
INTERACTION: O95273:CCNDBP1; NbExp=1; IntAct=EBI-594661, EBI-748961; P46527:CDKN1B; NbExp=1; IntAct=EBI-594661, EBI-519280; P10599:TXN; NbExp=5; IntAct=EBI-594661, EBI-594644; P09936:UCHL1; NbExp=1; IntAct=EBI-594661, EBI-714860; P40337:VHL; NbExp=1; IntAct=EBI-594661, EBI-301246;
SUBCELLULAR LOCATION: Cytoplasm. Nucleus.
DOMAIN: The JAMM motif is essential for the protease activity of the CSN complex resulting in deneddylation of cullins. It constitutes the catalytic center of the complex (By similarity).
MISCELLANEOUS: The CSN complex is associated with some 'Lys-63'- specific deubiquitination. Such activity is however not mediated by the core CSN complex but by the BRCC3/BRCC36 component of the BRISC complex.
SIMILARITY: Belongs to the peptidase M67A family. CSN5 subfamily.
SIMILARITY: Contains 1 MPN (JAB/Mov34) domain.
SEQUENCE CAUTION: Sequence=AAL82571.1; Type=Erroneous initiation;
| NCBI GenPept GI number(s): |
55976562 |
| Species: | Homo sapiens |
Links to other databases:
| Database | ID | Link |
| Uniprot | Q92905 |
Q92905 |
| PFAM: |
PF01398 |
PF01398 |
| InterPro: |
IPR000555 |
IPR000555 |
| CATH: | None | |
| SCOP: | None | |
| PDB: | - | - |
Protein sequence:
|
MAASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHH YFKYCKISALALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPV EGTETRVNAQAAAYEYMAAYIENAKQVGRLENAIGWYHSHPGYGCWLSGI DVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYPKGYKPPDEGP SEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSFMLGLETHDRKSEDKL AKATRDSCKTTIEAIHGLMSQVIKDKLFNQINIS |
COPS5 (Homo sapiens) belongs to following protein families:
References:
| Title | Authors | Journal |
| A new group of conserved coactivators that increase the specificity of AP-1 transcription factors. | Claret FX, Hibi M, Dhut S, Toda T, Karin M | Nature Oct. 3, 1996 |
| Structure of cDNAs encoding human eukaryotic initiation factor 3 subunits. Possible roles in RNA binding and macromolecular assembly. | Asano K, Vornlocher HP, Richter-Cook NJ, Merrick WC, Hinnebusch AG, Hershey JW | J Biol Chem Oct. 24, 1997 |
| A novel protein complex involved in signal transduction possessing similarities to 26S proteasome subunits. | Seeger M, Kraft R, Ferrell K, Bech-Otschir D, Dumdey R, Schade R, Gordon C, Naumann M, Dubiel W | FASEB J April 1, 1998 |
| The Bcl-3 oncoprotein acts as a bridging factor between NF-kappaB/Rel and nuclear co-regulators. | Dechend R, Hirano F, Lehmann K, Heissmeyer V, Ansieau S, Wulczyn FG, Scheidereit C, Leutz A | Oncogene June 3, 1999 |
| JAB1 interacts with both the progesterone receptor and SRC-1. | Chauchereau A, Georgiakaki M, Perrin-Wolff M, Milgrom E, Loosfelt H | J Biol Chem March 24, 2000 |
| Integrin LFA-1 interacts with the transcriptional co-activator JAB1 to modulate AP-1 activity. | Bianchi E, Denti S, Granata A, Bossi G, Geginat J, Villa A, Rogge L, Pardi R | Nature April 6, 2000 |
| Intracellular action of the cytokine MIF to modulate AP-1 activity and the cell cycle through Jab1. | Kleemann R, Hausser A, Geiger G, Mischke R, Burger-Kentischer A, Flieger O, Johannes FJ, Roger T, Calandra T, Kapurniotu A, Grell M, Finkelmeier D, Brunner H, Bernhagen J | Nature Nov. 9, 2000 |
| COP9 signalosome-specific phosphorylation targets p53 to degradation by the ubiquitin system. | Bech-Otschir D, Kraft R, Huang X, Henklein P, Kapelari B, Pollmann C, Dubiel W | EMBO J April 2, 2001 |
| Promotion of NEDD-CUL1 conjugate cleavage by COP9 signalosome. | Lyapina S, Cope G, Shevchenko A, Serino G, Tsuge T, Zhou C, Wolf DA, Wei N, Shevchenko A, Deshaies RJ | Science May 18, 2001 |
| Jab1 antagonizes TGF-beta signaling by inducing Smad4 degradation. | Wan M, Cao X, Wu Y, Bai S, Wu L, Shi X, Wang N, Cao X | EMBO Rep Jan. 1, 2002 |
| Intracrine hepatopoietin potentiates AP-1 activity through JAB1 independent of MAPK pathway. | Lu C, Li Y, Zhao Y, Xing G, Tang F, Wang Q, Sun Y, Wei H, Yang X, Wu C, Chen J, Guan KL, Zhang C, Chen H, He F | FASEB J Feb. 1, 2002 |
| Interaction and colocalization of PGP9.5 with JAB1 and p27(Kip1). | Caballero OL, Resto V, Patturajan M, Meerzaman D, Guo MZ, Engles J, Yochem R, Ratovitski E, Sidransky D, Jen J | Oncogene May 2, 2002 |
| Protein kinase CK2 and protein kinase D are associated with the COP9 signalosome. | Uhle S, Medalia O, Waldron R, Dumdey R, Henklein P, Bech-Otschir D, Huang X, Berse M, Sperling J, Schade R, Dubiel W | EMBO J March 17, 2003 |
| The ubiquitin ligase activity in the DDB2 and CSA complexes is differentially regulated by the COP9 signalosome in response to DNA damage. | Groisman R, Polanowska J, Kuraoka I, Sawada J, Saijo M, Drapkin R, Kisselev AF, Tanaka K, Nakatani Y | Cell May 2, 2003 |
| Serine/threonine kinase Mirk/Dyrk1B is an inhibitor of epithelial cell migration and is negatively regulated by the Met adaptor Ran-binding protein M. | Zou Y, Lim S, Lee K, Deng X, Friedman E | J Biol Chem Dec. 5, 2003 |
| Jab1/CSN5, a component of the COP9 signalosome, regulates transforming growth factor beta signaling by binding to Smad7 and promoting its degradation. | Kim BC, Lee HJ, Park SH, Lee SR, Karpova TS, McNally JG, Felici A, Lee DK, Kim SJ | Mol Cell Biol March 1, 2004 |
| Interaction between glucose-regulated destruction domain of DNA topoisomerase IIalpha and MPN domain of Jab1/CSN5. | Yun J, Tomida A, Andoh T, Tsuruo T | J Biol Chem July 23, 2004 |
| The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J | Genome Res Oct. 1, 2004 |
| The full-ORF clone resource of the German cDNA Consortium. | Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I | BMC Genomics Jan. 1, 2007 |
| Characterization of the human COP9 signalosome complex using affinity purification and mass spectrometry. | Fang L, Wang X, Yamoah K, Chen PL, Pan ZQ, Huang L | J Proteome Res Nov. 1, 2008 |
| K63-specific deubiquitination by two JAMM/MPN+ complexes: BRISC-associated Brcc36 and proteasomal Poh1. | Cooper EM, Cutcliffe C, Kristiansen TZ, Pandey A, Pickart CM, Cohen RE | EMBO J March 18, 2009 |
| Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. | Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S | Anal Chem June 1, 2009 |
| Lysine acetylation targets protein complexes and co-regulates major cellular functions. | Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M | Science Aug. 14, 2009 |
Last modification of this entry: Oct. 11, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|