|
|
Protein FULL name: single-stranded DNA-binding protein [Escherichia coli str. K-12 substr. MG1655].
Ssb (Escherichia coli strain K-12 substr. MG1655) is product of expression of
ssb
gene.
Ssb is involved in:
DDS in Escherichia coli strain K-12 substr. MG1655
FUNCTION: This protein is essential for replication of the
chromosomes and its single-stranded DNA phages. It is also
involved in DNA recombination and repair.
SUBUNIT: Homotetramer.
PTM: Phosphorylated on tyrosine residue(s).
SIMILARITY: Contains 1 SSB domain.
Links to other databases:
Protein sequence:
MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMK
EQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTT
EVVVNVGGTMQMLGGRQGGGAPAGGNIGGGQPQGGWGQPQQPQGGNQFSG
GAQSRPQQSAPAAPSNEPPMDFDDDIPF
|
References:
|
Title
|
Authors
|
Journal
|
|
Sequences of the ssb gene and protein.
|
Sancar A, Williams KR, Chase JW, Rupp WD
|
Proc Natl Acad Sci U S A
July 1, 1981
|
|
Biological activity and a partial amino-acid sequence of Escherichia coli DNA-binding protein I isolated from overproducing cells.
|
Beyreuther K, Berthold-Schmidt V, Geider K
|
Eur J Biochem
April 1, 1982
|
|
F sex factor encodes a single-stranded DNA binding protein (SSB) with extensive sequence homology to Escherichia coli SSB.
|
Chase JW, Merrill BM, Williams KR
|
Proc Natl Acad Sci U S A
Sept. 1, 1983
|
|
Characterization of the Escherichia coli SSB-113 mutant single-stranded DNA-binding protein. Cloning of the gene, DNA and protein sequence analysis, high pressure liquid chromatography peptide mapping, and DNA-binding studies.
|
Chase JW, L'Italien JJ, Murphy JB, Spicer EK, Williams KR
|
J Biol Chem
Feb. 25, 1984
|
|
Characterization of the structural and functional defect in the Escherichia coli single-stranded DNA binding protein encoded by the ssb-1 mutant gene. Expression of the ssb-1 gene under lambda pL regulation.
|
Williams KR, Murphy JB, Chase JW
|
J Biol Chem
Oct. 10, 1984
|
|
Tryptophan 54 and phenylalanine 60 are involved synergistically in the binding of E. coli SSB protein to single-stranded polynucleotides.
|
Casas-Finet JR, Khamis MI, Maki AH, Chase JW
|
FEBS Lett
Aug. 17, 1987
|
|
The single-stranded DNA-binding protein of Escherichia coli.
|
Meyer RR, Laine PS
|
Microbiol Rev
Dec. 1, 1990
|
|
Monomers of the Escherichia coli SSB-1 mutant protein bind single-stranded DNA.
|
Bujalowski W, Lohman TM
|
J Mol Biol
Feb. 5, 1991
|
|
Analysis of the Escherichia coli genome. IV. DNA sequence of the region from 89.2 to 92.8 minutes.
|
Blattner FR, Burland V, Plunkett G 3rd, Sofia HJ, Daniels DL
|
Nucleic Acids Res
Nov. 25, 1993
|
|
Identification and characterization of ssb and uup mutants with increased frequency of precise excision of transposon Tn10 derivatives: nucleotide sequence of uup in Escherichia coli.
|
Reddy M, Gowrishankar J
|
J Bacteriol
May 1, 1997
|
|
Crystal structure of the homo-tetrameric DNA binding domain of Escherichia coli single-stranded DNA-binding protein determined by multiwavelength x-ray diffraction on the selenomethionyl protein at 2.9-A resolution.
|
Raghunathan S, Ricard CS, Lohman TM, Waksman G
|
Proc Natl Acad Sci U S A
June 24, 1997
|
|
The complete genome sequence of Escherichia coli K-12.
|
Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y
|
Science
Sept. 5, 1997
|
|
Structure of the DNA binding domain of E. coli SSB bound to ssDNA.
|
Raghunathan S, Kozlov AG, Lohman TM, Waksman G
|
Nat Struct Biol
Aug. 1, 2000
|
|
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.
|
Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T
|
Mol Syst Biol
Jan. 1, 2006
|
|
Bacterial single-stranded DNA-binding proteins are phosphorylated on tyrosine.
|
Mijakovic I, Petranovic D, Macek B, Cepo T, Mann M, Davies J, Jensen PR, Vujaklija D
|
Nucleic Acids Res
Jan. 1, 2006
|
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|
