Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Cdc9p |
Protein FULL name:
DNA ligase
Protein SHORT name:
MMS8
Cdc9p (Saccharomyces cerevisiae) is product of expression of CDC9 gene.
Cdc9p is involved in:
BER in Saccharomyces cerevisiae
- Ligation of DNA strands by CDC9 after processing by Pol3 in Saccharomyces cerevisiae
- Ligation of DNA strands by CDC9 after processing by DPB3 in Saccharomyces cerevisiae
- CDC9 seals DNA (5' directed MMR) in Saccharomyces cerevisiae
- CDC9 seals DNA (3' directed MMR) in Saccharomyces cerevisiae
- DNA ligase I seals DNA (5' directed MMR) in Saccharomyces cerevisiae
- Ligation of the strand by CDC9 after processing by Pol3 in Saccharomyces cerevisiae
- Ligation of the strand by CDC9 after processing by DPB3 in Saccharomyces cerevisiae
Keywords:
- mismatch repair (MMR)
- transcription-coupled repair NER (TCR-NER)
- nucleotide excision repair (NER)
- base excision repair (BER)
- short path BER (SP-BER)
- long path BER (LP-BER)
- global genome repair NER (GGR-NER)
- DNA ligase
FUNCTION: DNA ligase that seals nicks in double-stranded DNA during DNA replication, DNA recombination and DNA repair. The mitochondrial form is required for mitochondrial DNA maintenance but is non-essential while the nuclear form is essential for cell viability.
CATALYTIC ACTIVITY: ATP + (deoxyribonucleotide)(n) + (deoxyribonucleotide)(m) = AMP + diphosphate + (deoxyribonucleotide)(n+m).
COFACTOR: Magnesium (By similarity).
INTERACTION: P15891:ABP1; NbExp=1; IntAct=EBI-5991, EBI-2036; P20449:DBP5; NbExp=1; IntAct=EBI-1009737, EBI-5617; P36156:ECM4; NbExp=1; IntAct=EBI-1009737, EBI-2042717;
SUBCELLULAR LOCATION: Nucleus. Mitochondrion.
MISCELLANEOUS: Cdc9 is included within the category of so-called 'start genes', encoding proteins which are required in early G1, when the cell is faced with the option of initiating a further cell cycle.
MISCELLANEOUS: Present with 149 molecules/cell in log phase SD medium.
SIMILARITY: Belongs to the ATP-dependent DNA ligase family.
| NCBI GenPept GI number(s): |
6320038 |
| Species: | Saccharomyces cerevisiae |
Links to other databases:
| Database | ID | Link |
| Uniprot | P04819 |
P04819 |
| PFAM: | - |
P04819 (Link - using uniprot id) |
| InterPro: | - |
P04819 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MRRLLTGCLLSSARPLKSRLPLLMSSSLPSSAGKKPKQATLARFFTSMKN KPTEGTPSPKKSSKHMLEDRMDNVSGEEEYATKKLKQTAVTHTVAAPSSM GSNFSSIPSSAPSSGVADSPQQSQRLVGEVEDALSSNNNDHYSSNIPYSE VCEVFNKIEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTYLFINRLGPD YEAGLELGLGENLLMKTISETCGKSMSQIKLKYKDIGDLGEIAMGARNVQ PTMFKPKPLTVGEVFKNLRAIAKTQGKDSQLKKMKLIKRMLTACKGIEAK FLIRSLESKLRIGLAEKTVLISLSKALLLHDENREDSPDKDVPMDVLESA QQKIRDAFCQVPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKPMLAKPTK AINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRNGENMTERYP EINITDFIQDLDTTKNLILDCEAVAWDKDQGKILPFQVLSTRKRKDVELN DVKVKVCLFAFDILCYNDERLINKSLKERREYLTKVTKVVPGEFQYATQI TTNNLDELQKFLDESVNHSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKD YLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTGEFETCCKIGT GFSDEMLQLLHDRLTPTIIDGPKATFVFDSSAEPDVWFEPTTLFEVLTAD LSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATSSDQIVELYENQ SHMQN |
Cdc9p (Saccharomyces cerevisiae) belongs to following protein families:
References:
| Title | Authors | Journal |
| The nucleotide sequence of the DNA ligase gene (CDC9) from Saccharomyces cerevisiae: a gene which is cell-cycle regulated and induced in response to DNA damage. | Barker DG, White JH, Johnston LH | Nucleic Acids Res Dec. 9, 1985 |
| Molecular structure and genetic regulation of SFA, a gene responsible for resistance to formaldehyde in Saccharomyces cerevisiae, and characterization of its protein product. | Wehner EP, Rao E, Brendel M | Mol Gen Genet March 1, 1993 |
| The nucleotide sequence of Saccharomyces cerevisiae chromosome IV. | Jacq C, Alt-Morbe J, Andre B, Arnold W, Bahr A, Ballesta JP, Bargues M, Baron L, Becker A, Biteau N, Blocker H, Blugeon C, Boskovic J, Brandt P, Bruckner M, Buitrago MJ, Coster F, Delaveau T, del Rey F, Dujon B, Eide LG, Garcia-Cantalejo JM, Goffeau A, Gomez-Peris A, Zaccaria P, et al. | Nature May 1, 1997 |
| The yeast CDC9 gene encodes both a nuclear and a mitochondrial form of DNA ligase I. | Willer M, Rainey M, Pullen T, Stirling CJ | Curr Biol Oct. 7, 1999 |
| Global analysis of protein expression in yeast. | Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS | Nature Oct. 16, 2003 |
| Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry. | Chi A, Huttenhower C, Geer LY, Coon JJ, Syka JE, Bai DL, Shabanowitz J, Burke DJ, Troyanskaya OG, Hunt DF | Proc Natl Acad Sci U S A Jan. 13, 2007 |
| Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae. | Hu Y, Rolfs A, Bhullar B, Murthy TV, Zhu C, Berger MF, Camargo AA, Kelley F, McCarron S, Jepson D, Richardson A, Raphael J, Moreira D, Taycher E, Zuo D, Mohr S, Kane MF, Williamson J, Simpson A, Bulyk ML, Harlow E, Marsischky G, Kolodner RD, LaBaer J | Genome Res April 1, 2007 |
| Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases. | Smolka MB, Albuquerque CP, Chen SH, Zhou H | Proc Natl Acad Sci U S A June 19, 2007 |
| A multidimensional chromatography technology for in-depth phosphoproteome analysis. | Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H | Mol Cell Proteomics July 1, 2008 |
Last modification of this entry: Oct. 19, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|