REPAIRtoire - a database of DNA repair pathways

Welcome! Click here to login or here to register.

Home

Bujnicki Lab Homepage

Pms1p

Protein FULL name:

ATP-binding protein required for mismatch repair in mitosis and meiosis; functions as a heterodimer with Mlh1p, binds double- and single-stranded DNA via its N-terminal domain, similar to E. coli MutL

Pms1p (Saccharomyces cerevisiae) is product of expression of PMS1 gene.

Keywords:

mismatch repair (MMR)

FUNCTION: Required for DNA mismatch repair (MMR), correcting base- base mismatches and insertion-deletion loops (IDLs) resulting from DNA replication, DNA damage or from recombination events between non-identical sequences during meiosis. Component of the MutLalpha heterodimer that forms a ternary complex with the MutS heterodimers, which initially recognize the DNA mismatches. This complex is thought to be responsible for directing the downsteam MMR events, including strand discrimination, excision, and resynthesis. Plays a major role in maintaining the genetic stability of simple sequence repeats and in the repair of heteroduplex sites present in meiotic recombination intermediates.

BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=1.5 mM for ATP;

SUBUNIT: Heterodimer of MLH1 and PMS1, called MutLalpha, which is the major MMR MutL activity correcting base-base mismatches as well as IDLs. The heterodimer binds double strand DNA independently of a mismatch with positive cooperativity and has more than one DNA binding site. Forms a ternary complex with either the MSH2-MSH6 (MutSalpha) or the MSH2-MSH3 heterodimer (MutSbeta), which recognize and bind to mismatch DNA. Ternary complex formation is promoted by ATP binding.

INTERACTION: P38920:MLH1; NbExp=1; IntAct=EBI-13561, EBI-11003;

SUBCELLULAR LOCATION: Nucleus.

MISCELLANEOUS: Present with 521 molecules/cell in log phase SD medium.

SIMILARITY: Belongs to the DNA mismatch repair mutL/hexB family.

SEQUENCE CAUTION: Sequence=AAA34885.1; Type=Erroneous initiation; Sequence=AAM00521.1; Type=Erroneous initiation; Sequence=AAM00533.1; Type=Erroneous initiation; Sequence=AAM00545.1; Type=Erroneous initiation; Sequence=AAM00551.1; Type=Erroneous initiation; Sequence=AAM00563.1; Type=Erroneous initiation; Sequence=AAM00569.1; Type=Erroneous initiation; Sequence=CAA60176.1; Type=Erroneous initiation; Sequence=CAA61428.1; Type=Erroneous initiation; Sequence=CAA95956.1; Type=Erroneous initiation; Sequence=CAA95957.1; Type=Erroneous initiation;

NCBI GenPept GI number(s):	46562124
Species:	Saccharomyces cerevisiae

Links to other databases:

Database	ID	Link
Uniprot	P14242	P14242
PFAM:	-	P14242 (Link - using uniprot id)
InterPro:	-	P14242 (Link - using uniprot id)
CATH:	-	-
SCOP:	-	-
PDB:	-	-

Protein sequence:

MTQIHQINDIDVHRITSGQVITDLTTAVKELVDNSIDANANQIEIIFKDY
GLESIECSDNGDGIDPSNYEFLALKHYTSKIAKFQDVAKVQTLGFRGEAL
SSLCGIAKLSVITTTSPPKADKLEYDMVGHITSKTTTSRNKGTTVLVSQL
FHNLPVRQKEFSKTFKRQFTKCLTVIQGYAIINAAIKFSVWNITPKGKKN
LILSTMRNSSMRKNISSVFGAGGMRGLEEVDLVLDLNPFKNRMLGKYTDD
PDFLDLDYKIRVKGYISQNSFGCGRNSKDRQFIYVNKRPVEYSTLLKCCN
EVYKTFNNVQFPAVFLNLELPMSLIDVNVTPDKRVILLHNERAVIDIFKT
TLSDYYNRQELALPKRMCSQSEQQAQKRLKTEVFDDRSTTHESDNENYHT
ARSESNQSNHAHFNSTTGVIDKSNGTELTSVMDGNYTNVTDVIGSECEVS
VDSSVVLDEGNSSTPTKKLPSIKTDSQNLSDLNLNNFSNPEFQNITSPDK
ARSLEKVVEEPVYFDIDGEKFQEKAVLSQADGLVFVDNECHEHTNDCCHQ
ERRGSTDTEQDDEADSIYAEIEPVEINVRTPLKNSRKSISKDNYRSLSDG
LTHRKFEDEILEYNLSTKNFKEISKNGKQMSSIISKRKSEAQENIIKNKD
ELEDFEQGEKYLTLTVSKNDFKKMEVVGQFNLGFIIVTRKVDNKYDLFIV
DQHASDEKYNFETLQAVTVFKSQKLIIPQPVELSVIDELVVLDNLPVFEK
NGFKLKIDEEEEFGSRVKLLSLPTSKQTLFDLGDFNELIHLIKEDGGLRR
DNIRCSKIRSMFAMRACRSSIMIGKPLNKKTMTRVVHNLSELDKPWNCPH
GRPTMRHLMELRDWSSFSKDYEI

Pms1p (Saccharomyces cerevisiae) belongs to following protein families:

fam50v00000001706

References:

Title	Authors	Journal
Cloning and nucleotide sequence of DNA mismatch repair gene PMS1 from Saccharomyces cerevisiae: homology of PMS1 to procaryotic MutL and HexB.	Kramer W, Kramer B, Williamson MS, Fogel S	J Bacteriol Oct. 1, 1989
Sequencing a cosmid clone of Saccharomyces cerevisiae chromosome XIV reveals 12 new open reading frames (ORFs) and an ancient duplication of six ORFs.	Pohlmann R, Philippsen P	Yeast March 1, 1996
The sequence of a 17,933 bp segment of Saccharomyces cerevisiae chromosome XIV contains the RHO2, TOP2, MKT1 and END3 genes and five new open reading frames.	Soler-Mira A, Saiz JE, Ballesta JP, Remacha M	Yeast April 1, 1996
The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications.	Philippsen P, Kleine K, Pohlmann R, Dusterhoft A, Hamberg K, Hegemann JH, Obermaier B, Urrestarazu LA, Aert R, Albermann K, Altmann R, Andre B, Baladron V, Ballesta JP, Becam AM, Beinhauer J, Boskovic J, Buitrago MJ, Bussereau F, Coster F, Crouzet M, D'Angelo M, Dal Pero F, De Antoni A, Hani J, et al.	Nature May 1, 1997
Functional domains of the Saccharomyces cerevisiae Mlh1p and Pms1p DNA mismatch repair proteins and their relevance to human hereditary nonpolyposis colorectal cancer-associated mutations.	Pang Q, Prolla TA, Liskay RM	Mol Cell Biol Aug. 1, 1997
ATP-dependent assembly of a ternary complex consisting of a DNA mismatch and the yeast MSH2-MSH6 and MLH1-PMS1 protein complexes.	Habraken Y, Sung P, Prakash L, Prakash S	J Biol Chem April 17, 1998
Functional specificity of MutL homologs in yeast: evidence for three Mlh1-based heterocomplexes with distinct roles during meiosis in recombination and mismatch correction.	Wang TF, Kleckner N, Hunter N	Proc Natl Acad Sci U S A Nov. 23, 1999
Functional studies on the candidate ATPase domains of Saccharomyces cerevisiae MutLalpha.	Tran PT, Liskay RM	Mol Cell Biol Sept. 1, 2000
Differential ATP binding and intrinsic ATP hydrolysis by amino-terminal domains of the yeast Mlh1 and Pms1 proteins.	Hall MC, Shcherbakova PV, Kunkel TA	J Biol Chem Jan. 1, 2002
Dissecting the architecture of a quantitative trait locus in yeast.	Steinmetz LM, Sinha H, Richards DR, Spiegelman JI, Oefner PJ, McCusker JH, Davis RW	Nature March 21, 2002
DNA binding properties of the yeast Msh2-Msh6 and Mlh1-Pms1 heterodimers.	Drotschmann K, Hall MC, Shcherbakova PV, Wang H, Erie DA, Brownewell FR, Kool ET, Kunkel TA	Biol Chem June 1, 2002
DNA binding by yeast Mlh1 and Pms1: implications for DNA mismatch repair.	Hall MC, Shcherbakova PV, Fortune JM, Borchers CH, Dial JM, Tomer KB, Kunkel TA	Nucleic Acids Res April 15, 2003
Sequencing and comparison of yeast species to identify genes and regulatory elements.	Kellis M, Patterson N, Endrizzi M, Birren B, Lander ES	Nature May 15, 2003
Global analysis of protein expression in yeast.	Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS	Nature Oct. 16, 2003
Global analysis of protein localization in budding yeast.	Huh WK, Falvo JV, Gerke LC, Carroll AS, Howson RW, Weissman JS, O'Shea EK	Nature Oct. 16, 2003
Novel PMS1 alleles preferentially affect the repair of primer strand loops during DNA replication.	Erdeniz N, Dudley S, Gealy R, Jinks-Robertson S, Liskay RM	Mol Cell Biol Nov. 1, 2005
Quantitative trait loci mapped to single-nucleotide resolution in yeast.	Deutschbauer AM, Davis RW	Nat Genet Dec. 1, 2005
Negative epistasis between natural variants of the Saccharomyces cerevisiae MLH1 and PMS1 genes results in a defect in mismatch repair.	Heck JA, Argueso JL, Gemici Z, Reeves RG, Bernard A, Aquadro CF, Alani E	Proc Natl Acad Sci U S A Jan. 28, 2006
Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases.	Smolka MB, Albuquerque CP, Chen SH, Zhou H	Proc Natl Acad Sci U S A June 19, 2007
A multidimensional chromatography technology for in-depth phosphoproteome analysis.	Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H	Mol Cell Proteomics July 1, 2008

Last modification of this entry: Oct. 6, 2010.

Add your own comment!

There is no comment yet.

Welcome stranger! Click here to login or here to register.