Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Ccl1p |
Ccl1p is involved in:
NER in Saccharomyces cerevisiae
Keywords:
FUNCTION: Regulatory component of the TFIIK complex (KIN28-CCL1 dimer) which is the protein kinase component of transcription factor IIH (TFIIH) and phosphorylates the C-terminal domain of RNA polymerase II during transition from transcription to elongation after preinitiation complex (PIC) formation, thereby positively regulating transcription. TFIIH (or factor B) is essential for both basal and activated transcription, and is involved in nucleotide excision repair (NER) of damaged DNA. TFIIH has DNA- dependent ATPase activity and is essential for polymerase II transcription in vitro.
SUBUNIT: CCL1 and KIN28 form the TFIIK complex, a component of TFIIH holo complex. Component of a complex consisting of KIN28, CCL1 and TFB3.
INTERACTION: P17157:PHO85; NbExp=1; IntAct=EBI-4385, EBI-13327; Q03290:TFB3; NbExp=1; IntAct=EBI-4385, EBI-31406;
MISCELLANEOUS: Present with 8700 molecules/cell in log phase SD medium.
SIMILARITY: Belongs to the cyclin family. Cyclin C subfamily.
This protein can be a part of a given complexes:
| NCBI GenPept GI number(s): |
6325282 |
| Species: | Saccharomyces cerevisiae |
Links to other databases:
| Database | ID | Link |
| Uniprot | P37366 |
P37366 |
| PFAM: | - |
P37366 (Link - using uniprot id) |
| InterPro: | - |
P37366 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MTDIQLNGKSTLDTPSATMSAKEKEAKLKSADENNKPPNYKRISDDDLYR HSSQYRMWSYTKDQLQEKRVDTNARAIAYIEENLLKFREAHNLTEEEIKV LEAKAIPLTMEEELDLVNFYAKKVQVIAQHLNLPTEVVATAISFFRRFFL ENSVMQIDPKSIVHTTIFLACKSENYFISVDSFAQKAKSTRDSVLKFEFK LLESLKFSLLNHHPYKPLHGFFLDIQNVLYGKVDLNYMGQIYDRCKKRIT AALLTDVVYFYTPPQITLATLLIEDEALVTRYLETKFPSREGSQESVPGN EKEEPQNDASTTEKNKEKSTESEEYSIDSAKLLTIIRECKSIIEDCKPPS TEEAKKIAAKNYYCQNPSTLIQKLKRKLNGEDTSSTVEKKQKT |
Ccl1p (Saccharomyces cerevisiae) belongs to following protein families:
References:
| Title | Authors | Journal |
| The kin28 protein kinase is associated with a cyclin in Saccharomyces cerevisiae. | Valay JG, Simon M, Faye G | J Mol Biol Nov. 20, 1993 |
| The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI. | Bussey H, Storms RK, Ahmed A, Albermann K, Allen E, Ansorge W, Araujo R, Aparicio A, Barrell B, Badcock K, Benes V, Botstein D, Bowman S, Bruckner M, Carpenter J, Cherry JM, Chung E, Churcher C, Coster F, Davis K, Davis RW, Dietrich FS, Delius H, DiPaolo T, Hani J, et al. | Nature May 1, 1997 |
| Genes for Tfb2, Tfb3, and Tfb4 subunits of yeast transcription/repair factor IIH. Homology to human cyclin-dependent kinase activating kinase and IIH subunits. | Feaver WJ, Henry NL, Wang Z, Wu X, Svejstrup JQ, Bushnell DA, Friedberg EC, Kornberg RD | J Biol Chem Aug. 1, 1997 |
| Kin28 is found within TFIIH and a Kin28-Ccl1-Tfb3 trimer complex with differential sensitivities to T-loop phosphorylation. | Keogh MC, Cho EJ, Podolny V, Buratowski S | Mol Cell Biol March 1, 2002 |
| Global analysis of protein expression in yeast. | Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS | Nature Oct. 16, 2003 |
Last modification of this entry: Oct. 19, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|