Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Tfb2p |
Protein FULL name:
Subunit of TFIIH and nucleotide excision repair factor 3 complexes, involved in transcription initiation, required for nucleotide excision repair, similar to 52 kDa subunit of human TFIIH
Tfb2p (Saccharomyces cerevisiae) is product of expression of TFB2 gene.
FUNCTION: Acts as component of the general transcription and DNA repair factor IIH (TFIIH) core, which is essential for both basal and activated transcription, and is involved in nucleotide excision repair (NER) of damaged DNA. TFIIH has CTD kinase and DNA-dependent ATPase activity, and is essential for polymerase II transcription in vitro.
SUBUNIT: Component of the TFIIH core complex, which is composed of RAD3, SSL1, SSL2, TFB1, TFB2, TFB4 and TFB5.
SUBCELLULAR LOCATION: Nucleus (By similarity).
MISCELLANEOUS: Present with 8900 molecules/cell in log phase SD medium.
SIMILARITY: Belongs to the TFB2 family.
This protein can be a part of a given complexes:
| NCBI GenPept GI number(s): |
6325135 |
| Species: | Saccharomyces cerevisiae |
Links to other databases:
| Database | ID | Link |
| Uniprot | Q02939 |
Q02939 |
| PFAM: | - |
Q02939 (Link - using uniprot id) |
| InterPro: | - |
Q02939 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MSDYSLKHSVTQYLEEIPQQVQNRLYTSPATCLAIYRILPPLAKFFIMAM VFNENEVPLLDLDKWVNSNGKLQFQNAIKSMKSLHLLIPNKSSGTLMINL NPTFKISLRNALTGGEVQNSFGVVVEENVVSLDLLDEYSANKWETILHFM VGTPLAKIPSEKVLNLLKHSKLMEEVNSTGEFKITNEGFQFLLQEINSQL WTLLLQYLKMIETSKMDLVDVLHFIFMLGALEVGKAYKIDALSETQRIML QDMRDYGLVFQKHSNDSIFYPTKLALMLTSDTKTIRSASNAMDSVLRQNR EEPSVNEDGANGKSTTDITTSDDLNKAGLKNQDIPDGSLIVETNFKIYSY SNSPLQIAVLSLFVHLKARFVNMVLGQITRESIRRALTNGITADQIIAYL ETHAHPQMRRLAEEKLEKKLELDPNCKEPLQVLPPTVVDQIRLWQLELDR VITYEGSLYSDFETSQEYNLLSKYAQDIGVLLWKDDKKKKFFISKEGNSQ VLDFAKRKLKKKQ |
Tfb2p (Saccharomyces cerevisiae) belongs to following protein families:
References:
| Title | Authors | Journal |
| RNA polymerase transcription factor IIH holoenzyme from yeast. | Svejstrup JQ, Feaver WJ, LaPointe J, Kornberg RD | J Biol Chem Nov. 11, 1994 |
| Reconstitution of TFIIH and requirement of its DNA helicase subunits, Rad3 and Rad25, in the incision step of nucleotide excision repair. | Sung P, Guzder SN, Prakash L, Prakash S | J Biol Chem May 3, 1996 |
| The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI. | Bussey H, Storms RK, Ahmed A, Albermann K, Allen E, Ansorge W, Araujo R, Aparicio A, Barrell B, Badcock K, Benes V, Botstein D, Bowman S, Bruckner M, Carpenter J, Cherry JM, Chung E, Churcher C, Coster F, Davis K, Davis RW, Dietrich FS, Delius H, DiPaolo T, Hani J, et al. | Nature May 1, 1997 |
| Genes for Tfb2, Tfb3, and Tfb4 subunits of yeast transcription/repair factor IIH. Homology to human cyclin-dependent kinase activating kinase and IIH subunits. | Feaver WJ, Henry NL, Wang Z, Wu X, Svejstrup JQ, Bushnell DA, Friedberg EC, Kornberg RD | J Biol Chem Aug. 1, 1997 |
| Global analysis of protein expression in yeast. | Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS | Nature Oct. 16, 2003 |
| Revised subunit structure of yeast transcription factor IIH (TFIIH) and reconciliation with human TFIIH. | Takagi Y, Komori H, Chang WH, Hudmon A, Erdjument-Bromage H, Tempst P, Kornberg RD | J Biol Chem Nov. 7, 2003 |
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|